DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina16

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:397 Identity:87/397 - (21%)
Similarity:149/397 - (37%) Gaps:49/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEAANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQ 65
            :::.|.|...:......:|..:......:|::.|||.:...|.||..........::.:.|....
  Rat    38 VTQGAPPFFNNQKFALSLYKQLPQPKRGKNLIFSPLGIIVPLVLLAFQDKPKARHQVLQDLGFTV 102

  Fly    66 RFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQT 130
            ..|.:.|.|:.|...|.|:....:..:...:.|.:......|..|.|:|.:.:::....:.....
  Rat   103 TGALDTKAASEYGKLLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGNY 167

  Fly   131 EKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAAN-LQSKWFLPFSAYRTGLYEFHSGS 194
            ...::.|...|.|...|...|.:.:.   ...|.|.|...| .:.||..||:...|.:..|....
  Rat   168 GLAQKQIDLAIRARTHGKITKLLRIL---KPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWLED 229

  Fly   195 QVKS-VPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLG 258
            ..|: |||:.....| :......:.:..::||:..:  :|.:..||:. |..:|.||.|.:....
  Rat   230 GTKTLVPMMQRVGWF-QLQYFSQMHSYVLQLPFTCS--ISGVFFLPDD-GKFEESEKALLEQSFE 290

  Fly   259 ALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFK----HLHAS------ANLP 313
            ...|...|....:..|||||        |: .|..|.:...::|.|    |:..|      |.|.
  Rat   291 TWIQPFPMSKRWLFFPKFSI--------PV-ALHLENLKHVNSNIKLFSEHMDLSRITLQKAPLT 346

  Fly   314 IADVLQKLRINLNESG---SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSE--NVT 373
            ::..:.::.:.:||.|   ..|.|| |..||.:            |.|:   |...|..|  |..
  Rat   347 VSTAVHRVELTVNEDGEEKDESQPE-PDLATLH------------FNRS---FLLLILDETSNSL 395

  Fly   374 YLMGHVV 380
            ..||.||
  Rat   396 LFMGKVV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 83/377 (22%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 87/395 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.