DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina6

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:368 Identity:87/368 - (23%)
Similarity:154/368 - (41%) Gaps:56/368 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAAN------PTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQ 60
            :|::|      ||..|  ....:|..:.....::|.::||:.:...|:::.|||  |..:.|| .
  Rat    25 NESSNSHRGLAPTNVD--FAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGS--AQTQSLQ-S 84

  Fly    61 LRLKQRFASNAKMANFYAAELGNITTDADTFLQLQ--NRLMLSSESGVADDFQKIAQTYFHATAE 123
            |.......|.|::...: ..|..:...:||.|::.  |.:.|..:..:.|.|....:.|:.:.|.
  Rat    85 LGFNLTETSEAEIHQSF-QYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEAL 148

  Fly   124 CVDLEQTEKLRRHISEQILASVGGGSWKDIHVAGG-SSANTLLLLLAANLQSKWFLPFSAYRTGL 187
            .:|.|...|..:.|::.:.....|   |..||... .|..:.:|:....|:..|.||||...|..
  Rat   149 AIDFEDWTKASQQINQHVKDKTQG---KIEHVFSDLDSPASFILVNYIFLRGIWELPFSPENTRE 210

  Fly   188 YEFH--SGSQVKSVPML--------FDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQR 242
            .:|:  ..|.|| |||:        |.|.:|         ..:.|::.|  ....:...|||:| 
  Rat   211 EDFYVNETSTVK-VPMMVQSGSIGYFRDSVF---------PCQLIQMDY--VGNGTAFFILPDQ- 262

  Fly   243 GGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLH 307
            |.:..:...|....:....:.|....|.:.:|||||.....|:..|:.|..:::....::|    
  Rat   263 GQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDF---- 323

  Fly   308 ASAN---LPIA-DVLQKLRINLNESGSGSGPELPKNATEYKPI 346
             |.|   :|:. .::.|..:.|:|     |..|| |:|...|:
  Rat   324 -SGNTKDVPLTLTMVHKAMLQLDE-----GNVLP-NSTNGAPL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 82/346 (24%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 84/356 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.