DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb6a

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:369 Identity:90/369 - (24%)
Similarity:164/369 - (44%) Gaps:55/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL-----------KQRFASNAKMANFYAAE 80
            :..|:.:||:.:.|.|:::|:|:.|.||.::.:.|.|           .|.|.|       ..||
  Rat    44 SSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVHQGFQS-------LLAE 101

  Fly    81 LGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLE-QTEKLRRHISEQILAS 144
            :..  |.....|:..|||.......:...|:...:.::.|..|.:|.: .||:.|:.|:..: |.
  Rat   102 VNK--TGTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDFKGDTEQSRQRINTWV-AK 163

  Fly   145 VGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDM 207
            ......|::...|....:|:|:|: |...:..|...|:...|....|. |.::.|.|.|:|....
  Rat   164 KTEDKIKELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTREKPFKVSKTEEKPVQMMFMKST 228

  Fly   208 FVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--------HDLDLGALQQRM 264
            | |...:.::..:.:.|||. ..||:|:::||::...|:.:||:|        ..||:      :
  Rat   229 F-KMTYIGEIFTKILLLPYA-GNELNMIIMLPDEHIELKTVEKELTYEKFIEWTRLDM------L 285

  Fly   265 QMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNES 328
            ..|.|:|.||:|.::....::..|.:||..:.| ...|:|..:.:...|.::.|:.|..:.:||.
  Rat   286 DEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAFMEGRADFSGIASKQGLFLSKVIHKAFVEVNEE 350

  Fly   329 G----SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR 368
            |    :.:|..:......:.|          .|.|||||.|.|:
  Rat   351 GTEAVAATGSTITMRCLRFTP----------RFLADHPFLFFIQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 90/369 (24%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 90/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.