DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb8

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:358 Identity:85/358 - (23%)
Similarity:163/358 - (45%) Gaps:26/358 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITTDADTFLQ 93
            :|:...|:.:.:.|::::||:.|.||.::.:.|.|    :.:..:...:...|..:......:| 
  Rat    26 RNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGL----SGDGDVHQGFQTLLAEVNKSGTQYL- 85

  Fly    94 LQNRLMLSSESG--VADDFQKIAQTYFHATAECVD-LEQTEKLRRHISEQILASVGGGSWKDIHV 155
            |::...|..|..  ....|::..|.::.|..|.:. ::.||..|:.|::.:|....|...:.:..
  Rat    86 LKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVKDTEGCRKRINDWVLEKTEGKISEVLSP 150

  Fly   156 AGGSSANTLLLLLAANLQSKWFLPFS-AYRTGLYEFHSGSQVKSVPMLFDDDMFVKFAELRDLDA 219
            ........|:|:.|...:.||...|. .|..|:....:..:.|:|.|:|....| |.|.:.:::|
  Rat   151 GTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEEKKTVQMMFKHAKF-KMAHVDEVNA 214

  Fly   220 RAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRMQMEGVQVLLPKFSIDFEC 282
            :.:.|||.. :||||:::||::...|..:||.|  ..|......:.:....|||..|:..::...
  Rat   215 QVLALPYAE-DELSMVVLLPDESSDLTVVEKALTYEKLRAWTNPETLTESKVQVFFPRLKLEESY 278

  Fly   283 SLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPI 346
            .|...|:.||..:.| ...|:|..:.:..|:|::.|..|..:.:||.|:.:.      ||   ..
  Rat   279 DLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKCFVEVNEEGTEAA------AT---TA 334

  Fly   347 VISNSSRQKF---FRADHPFFFAIRSENVTYLM 376
            ||.|:...:.   |.||.||.|.|..:..:.::
  Rat   335 VIRNTRSCRIEPRFCADRPFLFFIWHQKTSSIL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 85/358 (24%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 85/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.