DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinf2

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:359 Identity:83/359 - (23%)
Similarity:153/359 - (42%) Gaps:31/359 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            ::..:|.:....|:|:|||.:...||.|.||:...|.|.||:.|.:.........:::|    ..
  Rat    93 LFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHLLSHF----CQ 153

  Fly    83 NITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVGG 147
            |:....   ::|..|:.|.....:.|||.:.::..|.|....:...|.|.| .:|::.:..:..|
  Rat   154 NLNPGT---IRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDL-MNINKWVKEATEG 214

  Fly   148 GSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGSQVKSVP--MLFDDDMFV 209
               |..........||:|||| |.:....|...|....|....||...|. :||  |:......:
  Rat   215 ---KIEDFLSELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQF-TVPVAMMHAQSYPL 275

  Fly   210 KFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGAL-QQRMQMEGVQVLL 273
            ::..|...:.:....|:::  .:|.::|:|...|  ..:.:.|.:|....| |..|:.:..:|.|
  Rat   276 RWFLLEQPEIQVAHFPFQN--NMSFVVIMPTYFG--WNVSEVLANLTWDTLYQPSMREKPTKVRL 336

  Fly   274 PKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPK 338
            ||..::....|...|.:||.:::| .|.:.:.: :..:|.::.|..:..:.|:|:|        .
  Rat   337 PKLHLEQHLDLVATLSKLGLQDLF-QSPDLRGI-SDQSLVVSSVQHQSTMELSEAG--------V 391

  Fly   339 NATEYKPIVISNSSRQKFFRADHPFFFAIRSENV 372
            .|.......::..|...|| .:.||.|.|..|.:
  Rat   392 EAAAATSTAMTRMSLSSFF-LNRPFIFFIMEETI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 83/359 (23%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 83/359 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.