DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb1b

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:374 Identity:97/374 - (25%)
Similarity:172/374 - (45%) Gaps:45/374 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFY---AA 79
            ::|::..|....|:..||..:.::|:::|||:.|:||.:|.|.|    .|.|...:.:.:   .|
Mouse    15 LFHTLKESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTL----HFDSVEDIHSCFQSLTA 75

  Fly    80 ELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ-TEKLRRHISEQILA 143
            |:..:  .|...|:|.|||..........:|....|..:.|....||.:. :|..|:.|::.:..
Mouse    76 EVSKL--GASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDARKEINQWVKG 138

  Fly   144 SVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDM 207
            ...|...:.:......|...|:|:.|...:..|...|....|....|. :....|:|.|::....
Mouse   139 QTEGKIPELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKKDTKTVKMMYQKKK 203

  Fly   208 FVKFAELRDLDARAIELPYEHAEELSMLLILP----NQRGGLQELEKQLHDLDLGALQQRMQMEG 268
            | .|..:.||..:.:|:||: ..||||:::||    ::..||:::|:|   |.||.|.:..:.|.
Mouse   204 F-PFGYISDLKCKVLEMPYQ-GGELSMVILLPEDIEDESTGLKKIEEQ---LTLGKLHEWTKHEN 263

  Fly   269 -----VQVLLPKFSIDFECSLRQPLKQLGFEEIFAA-SANFKHLHASANLPIADVLQKLRINLNE 327
                 |.|.||:|.::....|...|..||.:::|:: .|:...:..|.:|.::.::.|..:::||
Mouse   264 LRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGKADLSGMSGSRDLFVSKIVHKSFVDVNE 328

  Fly   328 SGSGSGPELPKNAT--------EYKPIVISNSSRQKFFRADHPFFFAIR 368
            .|:.:..     ||        |..|      :.|:.|..||||.|.||
Mouse   329 QGTEAAA-----ATGGIIQVLCEKMP------TPQEVFTVDHPFLFFIR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 97/374 (26%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 97/374 (26%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 9/15 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.