DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina3b

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:380 Identity:81/380 - (21%)
Similarity:164/380 - (43%) Gaps:41/380 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGN 83
            |..:|.....:|:..||..:...|:.|.||:.|.|.||:.:.|:......|.|.:...:...|..
Mouse    59 YKELALKNPHKNIAFSPFGIATALNSLTLGAKGNTLEEILEVLKFNLTETSEADIHQGFKHLLQR 123

  Fly    84 ITTDADTFLQLQ----NRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILAS 144
            ::...|   |:|    |.|.:.....:..:|::.|:..:|......:.:|..:..:.|:..:...
Mouse   124 LSHPGD---QVQIRTGNALFVEKHLQILAEFKEKARALYHTEVFTANFQQPHEAMKLINSYMSNQ 185

  Fly   145 VGGGSWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPFSAYRT--GLYEFHSGSQVKSVPMLFD 204
            ..|   |...:......||.::::  |   .:::|.:||::..|  |.:.......|| |||:..
Mouse   186 TQG---KIKELVSDMDGNTSMVIV--NDLFFKAEWMVPFNSDDTFMGKFIVDRSRHVK-VPMMKT 244

  Fly   205 DDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGV 269
            .::...:....:|....:||.|:...:  .:.|||:| |.:|::|..|....|...::.::...:
Mouse   245 KNLRTPYFRDEELKCTVVELNYKGNGK--AMFILPDQ-GKMQQVEASLQPGTLKKWRKSLRPRKI 306

  Fly   270 QVL-LPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSG 333
            :.| |||||:....:|...|.:||..|:|:..|:...:....|:.:::::....:::.|.|    
Mouse   307 KELHLPKFSLSQHYNLEDILPELGIRELFSTQADLSGITGVKNITVSEMIHSTELDMTEKG---- 367

  Fly   334 PELPKNATEYKPIVI------SNSSRQKFFRADHPFFFAIRSENVTYL--MGHVV 380
                   ||...|.|      |...:..|.:.:..|.:.:..:...::  ||.|:
Mouse   368 -------TEGDAITIVGYNFMSAKLKPVFVKFEDQFLYIVLDQGDLWIHVMGKVI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 80/377 (21%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 80/377 (21%)
RCL 367..392 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.