DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb10

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:379 Identity:91/379 - (24%)
Similarity:169/379 - (44%) Gaps:39/379 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK--QRF-----ASNAKMANFYAA 79
            :|.|...:|:..||..:..:|::::||:.|.||.::.:.|...  |.|     :...:....::.
  Rat    19 LAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDSEKKRKMECHSG 83

  Fly    80 ELGNITTDADTF------------LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVD-LEQTE 131
            :...|.:|..|.            |::.||:.:.......:.:.:..:|||.|..:.|: :|.:.
  Rat    84 KSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAEPQSVNFVEASG 148

  Fly   132 KLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFHSGSQV 196
            ::|:.|:..:.:..||.....:......:..|::|:.|...:..|...||...|....|......
  Rat   149 QIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQNTTERPFRINKTT 213

  Fly   197 KSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGA 259
            .....:......::...:.:|....::|.|:: .|.|:||:||.:..||::||:.:  ..||...
  Rat   214 SKPVQMMSMKQSLQVFHIEELQTIGVQLHYQN-REFSLLLLLPEEVEGLKQLERAITYEKLDKWT 277

  Fly   260 LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRI 323
            ....|....||:.||||.::....|:..|:.:|..:.| ...|||.::.:..||.:::|..|..:
  Rat   278 SADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTSERNLFLSNVFHKTFL 342

  Fly   324 NLNESG----SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVT 373
            .:||.|    :|:|.|:  |.....|.:..|        |||||.|.|| .|||
  Rat   343 EINEEGTEAAAGTGSEV--NFRIKAPSIELN--------ADHPFLFLIR-HNVT 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/379 (24%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 91/379 (24%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.