DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA11

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:367 Identity:89/367 - (24%)
Similarity:141/367 - (38%) Gaps:86/367 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAK 72
            ||...:....:|..:|.. |..|:..||:.:..||:||.||:...|:..:.:.|           
Human    51 TPTITNFALRLYKELAAD-APGNIFFSPVSISTTLALLSLGAQANTSALILEGL----------- 103

  Fly    73 MANFYAAELGNITTDADT---FLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLR 134
              .|...|    |.:||.   |..|.:.|.|.|.....    |:..:.|        |::..|.|
Human   104 --GFNLTE----TPEADIHQGFRSLLHTLALPSPKLEL----KVGNSLF--------LDKRLKPR 150

  Fly   135 RHISEQILASVGGGSWKDIHVAGGSSAN---------------------------------TLLL 166
            :|..:.|         |:::.|...|||                                 |.::
Human   151 QHYLDSI---------KELYGAFAFSANFTDSVTTGRQINDYLRRQTYGQVVDCLPEFSQDTFMV 206

  Fly   167 LLAAN---LQSKWFLPFSAYRTGLYE--FHSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPY 226
            |  ||   .::||..|||.|:|...|  |........|||:...:|. :|  |.|.|.....|..
Human   207 L--ANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMH-RF--LYDQDLACTVLQI 266

  Fly   227 EHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQL 291
            |:......||:||:. |.::::|..|....|....|.:....:.:.||:|||....:|...|.|:
Human   267 EYRGNALALLVLPDP-GKMKQVEAALQPQTLRKWGQLLLPSLLDLHLPRFSISGTYNLEDILPQI 330

  Fly   292 GFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSG 333
            |...|....|:|..:....|..|:.|..|..::::|.|:.:|
Human   331 GLTNILNLEADFSGVTGQLNKTISKVSHKAMVDMSEKGTEAG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 87/357 (24%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 87/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.