DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina3c

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:375 Identity:94/375 - (25%)
Similarity:174/375 - (46%) Gaps:31/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:|....::|||.|||.:.|.|::|.||:..:|.||:.:.|:......:..::...:...|.
  Rat    56 LYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQ 120

  Fly    83 NITTDAD-TFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVG 146
            .::...| ..:...:.|.:..|..:..:||:..:..:.|.|...|.:|..:.::.|::.:.....
  Rat   121 RLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNEAKKFINDYVSNQTQ 185

  Fly   147 GGSWKDIHVAGGSSANTLLLLLAANL-QSKWFLPFSAYRTGLYEFHSGSQ--VKSVPMLFDDDMF 208
            |   |...:.......|.::|:...| :.||.:||:...|...||:...:  || |||:...|:.
  Rat   186 G---KIAELFSDLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVK-VPMMKIKDLT 246

  Fly   209 VKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDL----GALQQRMQMEGV 269
            ..:....:|....:||.|  ....|.|.|||:| |.:|::|..|....|    .:|:.|:..|  
  Rat   247 TPYVRDEELSCSVLELKY--TGNASALFILPDQ-GKMQQVESSLQPETLKKWKDSLRPRIISE-- 306

  Fly   270 QVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGS-GSG 333
             :.:|||||..:.:|.:.|.:||..:||:..|:...:..:.||.::.|:.|..::::|:|: |:.
  Rat   307 -LRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRITGTKNLHVSQVVHKAVLDVDETGTEGAA 370

  Fly   334 PELPKNATEYKP--IVISNSSRQKFFRADHPFFFAIRSEN--VTYLMGHV 379
            ......|.:..|  :.:.|.:|        ||...|...|  ..:.||.|
  Rat   371 ATAVTAALKSLPQTVPLLNFNR--------PFMLVITDNNGQSVFFMGKV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/373 (25%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 94/375 (25%)
RCL 365..392 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.