DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb13

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:391 Identity:94/391 - (24%)
Similarity:165/391 - (42%) Gaps:80/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASN------------------------ 70
            ||..||:.:...:.::.||:.||||.||||.|..:|...|:                        
Mouse    26 NVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIKSEEEEIEKREEIHHQLQMLLT 90

  Fly    71 --AKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-----E 128
              :|.:|.|...:.|......|:|.||..:          |:   .:.|:||:.|.||.     |
Mouse    91 EISKFSNDYDLIISNRLFGEKTYLFLQKYI----------DY---VEKYYHASLEPVDFVNAADE 142

  Fly   129 QTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHS 192
            ..:|:...:..|....|     ||:...|..:::|.|:|: ....:..|...|....|...:|..
Mouse   143 SRKKINSWVESQTNVKV-----KDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWL 202

  Fly   193 GSQV-KSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQEL------EK 250
            ...: |.|.|:.....| .|..|.||.|:.:.:||:: .::||.::|||...||:::      ||
Mouse   203 NKNLSKPVQMMALCSSF-NFTFLEDLQAKIVGIPYKN-NDISMFVLLPNDIDGLEKIMDKMSPEK 265

  Fly   251 QLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIA 315
            .:.....|.|:||.    |.:.||:..::....|...|:.:|....|:..|::..:.|.:.|...
Mouse   266 LVEWTSPGHLEQRR----VDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQ 326

  Fly   316 DVLQKLRINLNESG----SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR---SENVT 373
            :.|.:..:.:.|.|    :|:|..|.          :|:::..:....:|||.|.||   |:::.
Mouse   327 NFLHRSFLVVTEEGVEATAGTGVGLK----------VSSAASCELVHCNHPFLFFIRHRESDSIL 381

  Fly   374 Y 374
            :
Mouse   382 F 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 94/391 (24%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 94/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.