DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb6a

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:367 Identity:90/367 - (24%)
Similarity:162/367 - (44%) Gaps:54/367 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL-----------KQRFASNAKMANFYAAE 80
            :.:||.:||:.:.:.|:::|:|:.|.||.::.:.|.|           .|.|.|.....|     
Mouse    44 SSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDKCSGNGGGDVHQGFQSLLTEVN----- 103

  Fly    81 LGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLE-QTEKLRRHISEQILAS 144
                .|.....|:..|||.......:...|:.....::.|..|.:|.: .||:.|:||:..: |.
Mouse   104 ----KTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEESRQHINTWV-AK 163

  Fly   145 VGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDM 207
            ......|::...|..:::|.|:|: |...:..|...|:...|....|. |.::.|.|.|:|....
Mouse   164 KTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVSKNEEKPVQMMFKKST 228

  Fly   208 FVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--------HDLDLGALQQRM 264
            | |...:.::..:.:.|||. :.||:|:::||::...|..:||::        ..||      :|
Mouse   229 F-KMTYIGEIFTKILLLPYV-SSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTRLD------KM 285

  Fly   265 QMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESG 329
            ..|.|:|.||||.::...::...|.:||..:.|...|:|..:.:...|.::.|:.|..:.:||.|
Mouse   286 DEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLFLSKVVHKAFVEVNEEG 350

  Fly   330 ----SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAI 367
                :.:...:......:.|          .|.|||||.|.|
Mouse   351 TEAAAATAGMMTVRCMRFTP----------RFCADHPFLFFI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 90/367 (25%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 90/367 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.