DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina3n

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:373 Identity:95/373 - (25%)
Similarity:173/373 - (46%) Gaps:47/373 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SIATSFA------------EQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKM 73
            ||.|.||            ::|:|.|||.:.|.|:::.||:.|.|.||:.:.|:......|.|.:
Mouse    49 SINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADI 113

  Fly    74 ANFYAAELGNITTDADTFLQLQ----NRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLR 134
            ...:...|..:....|   |:|    :.|.:.....:..:||:.|:..:.|.|...|.:|..:.:
Mouse   114 HQGFGHLLQRLNQPKD---QVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQAK 175

  Fly   135 RHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFHSGS-QVKS 198
            :.|::.:.... .|..|:: |:.......::|:.....::||.:||....|...||::|. :...
Mouse   176 KLINDYVRKQT-QGMIKEL-VSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVI 238

  Fly   199 VPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDL----GA 259
            |||:..:|:...:....:|....:||.|  ....|.:.|||:| |.:|::|..|....|    .:
Mouse   239 VPMMSMEDLTTPYFRDEELFCTVVELKY--TGNASAMFILPDQ-GKMQQVEASLQPETLRKWKNS 300

  Fly   260 LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRIN 324
            |:.||..|   :.||||||..:.||...|.:||..|:|:..|:...:..:.:|.::.|:.|..::
Mouse   301 LKPRMIDE---LHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLD 362

  Fly   325 LNESGSGSGPE-----LPKNATEYKPIVISNSSRQKFFRADHPFFFAI 367
            :.|:|:.:...     :|.:|..| |:.:       :|  :.||...|
Mouse   363 VAETGTEAAAATGVKFVPMSAKLY-PLTV-------YF--NRPFLIMI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 95/373 (25%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 95/373 (25%)
RCL 367..392 5/32 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.