DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina3g

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:336 Identity:83/336 - (24%)
Similarity:153/336 - (45%) Gaps:48/336 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLR----------LKQRFASNAK 72
            :|..:.....::|||.||..:...|:||.||:...|.:|:.:.|:          :.|.|.    
Mouse    48 LYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFR---- 108

  Fly    73 MANFYAAEL----GN---ITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQT 130
                |..:|    ||   |:|.:..|::...:::.        :|::.|:..:.|.|...|.:|.
Mouse   109 ----YLLDLLSQPGNQVQISTGSALFIEKHLQILA--------EFKEKARALYQAEAFTADFQQP 161

  Fly   131 EKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFHSGSQ 195
            .|..:.|::.: ::...|..|.: ::|...:..::|:.....:.||..||....|...||:. .:
Mouse   162 LKATKLINDYV-SNHTQGKIKQL-ISGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYL-DE 223

  Fly   196 VKSVPMLFDDDMFVKFAELRD--LDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDL- 257
            .:||.:......::.....||  |....:||.|  ....|.:.|||:| |.:|::|..|....| 
Mouse   224 KRSVIVSMMKTGYLTTPYFRDEELSCTVVELKY--TGNASAMFILPDQ-GRMQQVEASLQPETLR 285

  Fly   258 ---GALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQ 319
               .:|:.||..|   :.||||||..:.||...|.:||..|:|:..|:...:..:.:|.::.|:.
Mouse   286 KWKNSLKPRMIHE---LRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKDLRVSQVVH 347

  Fly   320 KLRINLNESGS 330
            |..:::.|.|:
Mouse   348 KAVLDVAEKGT 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 83/336 (25%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 83/336 (25%)
RCL 357..382 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.