DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb6b

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus


Alignment Length:365 Identity:90/365 - (24%)
Similarity:163/365 - (44%) Gaps:49/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL-----------KQRFASNAKMANFYAAE 80
            :.:||:.||:.:.:.|:::|:|:.|.||.::.:.|.|           .|.|.|.....|     
Mouse    23 SSRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGKGGRDVHQGFQSLLTETN----- 82

  Fly    81 LGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLE-QTEKLRRHISEQILAS 144
                .|.....|:..|||.......:...|:...:.::.|..|.:|.: .||:.|:||:..: |.
Mouse    83 ----KTGTQYVLRTANRLFGEKTFDILASFKDSCRKFYEAEMEELDFKGATEQSRQHINAWV-AK 142

  Fly   145 VGGGSWKDIHVAGGSSANT-LLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDM 207
            .......::..:|..::|| |:|:.|...:..|...|:...|....|: :...||.|.|:|....
Mouse   143 KTEDKITELLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMPFNVTKDVVKPVQMMFQKST 207

  Fly   208 FVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--------HDLDLGALQQRM 264
            | |...:.::....:.|||. ..||:|:::||::...|..:||::        ..||      :|
Mouse   208 F-KMTYVEEISTNILLLPYV-GNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLD------KM 264

  Fly   265 QMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNES 328
            :.|.|:|.||||.::....::..|.:||..:.| ...|:|..:.:...|.::.|:.|..:.:||.
Mouse   265 EEEEVEVFLPKFKLEENYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVIHKSFVEVNEE 329

  Fly   329 GSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR 368
            |:.:......|        |.......:|.|:|||.|.|:
Mouse   330 GTEAAAATAAN--------IGFRCMVPYFCANHPFLFFIQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 90/365 (25%)
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 90/365 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.