DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb9c

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:353 Identity:82/353 - (23%)
Similarity:158/353 - (44%) Gaps:15/353 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITTDADTFLQ 93
            :||..||:.:.:.|::..||..|.|..::.:.:.|..  |.:...:..:...:....|...|| :
Mouse    53 KNVCYSPINISSALAMFLLGVKGNTEIQISEAIGLNT--AIDIHQSFLWILNILKKPTRKYTF-R 114

  Fly    94 LQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQT-EKLRRHISEQILASVGGGSWKDIHVAG 157
            :.|||...:.......|::....::|...|.:...:. |:.|.||:..:..:..|...:.:....
Mouse   115 MANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINTWVCKNTKGKIPELLSSGS 179

  Fly   158 GSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELRDLDARA 221
            ..|...|:|:.|...:.:|...|....|....|. :..:.:.|.|:|.:||| |.|.:.::..:.
Mouse   180 VDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERPVQMMFQEDMF-KLAYVNEVQVQV 243

  Fly   222 IELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVL--LPKFSIDFECSL 284
            :.|||: .:|||::::||:....|.::|..|....|.|..:...::..:||  ||||.::....:
Mouse   244 LVLPYK-GKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDYLKTTKVLVFLPKFKLEDYYDM 307

  Fly   285 RQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVI 348
            ....:.||..:|| ...|:...:.....|.::..:||..:.:||.|:.:     ..||....:..
Mouse   308 ESIFQDLGVGDIFQGGKADLSEMSPERGLCVSKFIQKCVVEVNEEGTEA-----TAATADDTVCS 367

  Fly   349 SNSSRQKFFRADHPFFFAIRSENVTYLM 376
            :.:...:.|.|||||.|.||......::
Mouse   368 AETHDGQTFCADHPFLFFIRHNKTNSIL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 82/353 (23%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 82/353 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.