DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb9b

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:373 Identity:87/373 - (23%)
Similarity:157/373 - (42%) Gaps:40/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK------QRFASNAKMANFYAAE 80
            :..|...:||..||:.:.:.|:::.||:...||.::.:.|.||      |.|....:..|     
Mouse    19 LCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGLKKEKGIHQGFLKLLRKLN----- 78

  Fly    81 LGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVD-----LEQTEKLRRHISEQ 140
                ..|....|.:.|||.......|...|::....::.:..|.|:     :|..:.:...:|:|
Mouse    79 ----KPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESRQCINTWVSKQ 139

  Fly   141 ILASVGGGSWKDIHVAGGSSAN---TLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPM 201
            ....:.       .:....|.|   .|:|:.|...:..|...|....|....|: :..:.:.|.|
Mouse   140 TEGKIP-------ELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRPVQM 197

  Fly   202 LFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRM 264
            :...|.|: ||.:.:|.||.:.:||| ..|||::::||.:...|.::|..|  ..|........|
Mouse   198 MCQTDTFM-FAFVDELPARLLIMPYE-GMELSLMVLLPEKGVDLSKVENDLTFEKLIAWTKPDIM 260

  Fly   265 QMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNES 328
            ....|:|.||||.:..:..::..|:.||..::| ...|:...:....||.::..:.|..:.:||.
Mouse   261 WSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAMSPERNLCLSKFIHKSVVEVNEE 325

  Fly   329 GSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            |:.:.  ...:|....|:.:...  ..:|.|||||.|.||......::
Mouse   326 GTEAA--AASSAEGIIPLCLGGG--PSWFCADHPFLFFIRHNQTNSIL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 87/373 (23%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 87/373 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.