DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina1e

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:395 Identity:87/395 - (22%)
Similarity:163/395 - (41%) Gaps:60/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HSIATSFAE---------------QNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFAS 69
            |.|||:..:               .|:..||:.:....::|.|||.|.|..::.:.|:......|
Mouse    42 HEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTS 106

  Fly    70 NAKMANFYAAELGNIT-TDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKL 133
            .|.:.|.:...|..:. .|::..|...|.|.::::..:.:.|.:.|:.::.|....|:..::|:.
Mouse   107 EADIHNSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEA 171

  Fly   134 RRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPFSAYRTGLYEFH-SGS 194
            ::.|::.:.....|   |.:........:|:.:|  ||   .:.||..||....|...||| ..|
Mouse   172 KKVINDFVEKGTQG---KIVEAVKKLEQDTVFVL--ANYILFKGKWKKPFDPENTKQAEFHVDES 231

  Fly   195 QVKSVPMLFDDDMFVKFAELRDLDARAIE------LPYEHAEELSMLLILPNQRGGLQELEKQLH 253
            ....|||:....|         ||.....      |..::|...:.:.:||:. |.:|.||:.|:
Mouse   232 TTVKVPMMTLSGM---------LDVHHCSTLSSWVLLMDYAGNATAVFLLPDD-GKMQHLEQTLN 286

  Fly   254 D--LDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHL-HASANLPIA 315
            .  :....|.:|.::  .|:.:|:.||....:|...:..||...||.:.|:...: ..:|.|.::
Mouse   287 KELISKFLLNRRRRL--AQIHIPRLSISGNYNLETLMSPLGITRIFNSGADLSGITEENAPLKLS 349

  Fly   316 DVLQKLRINLNESG--SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSEN--VTYLM 376
            ..:.|..:.::|:|  :.:...|........||:..|          .||.|.|..|:  ....:
Mouse   350 QAVHKAVLTIDETGTEAAAATVLQGGFLSMPPILHFN----------RPFLFIIFEEHSQSPLFV 404

  Fly   377 GHVVE 381
            |.||:
Mouse   405 GKVVD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 85/391 (22%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 83/384 (22%)
RCL 368..387 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.