DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb3a

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:386 Identity:94/386 - (24%)
Similarity:173/386 - (44%) Gaps:40/386 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:..|  :.|:..||:.:...|::|.||:.|.|.::::|.|    :|....|.....:|...
Mouse    15 LYRQLRES--DNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVL----QFNETTKKTTEKSAHCH 73

  Fly    83 NITTDADTFLQLQNRLMLSSES---------------GVADDFQKIAQTYFHATAECVDLEQ-TE 131
            :.....:.|.:|..:|..|:::               .....|.:..:.|:.|..|.:|.|. .|
Mouse    74 DEENVHEQFQKLMTQLNKSNDAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQANVESLDFEHAAE 138

  Fly   132 KLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGSQ 195
            :..:.|:..: .|...|..||:...|..:.:|:::|: |...:.:|...|....|...:|.....
Mouse   139 ESEKKINSWV-ESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKFWLNKN 202

  Fly   196 VKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLG 258
            ......:...::...|..|.|:.|:.:|:||: .:||||:::||.:..||::||:||  ..|...
Mouse   203 TSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYK-GKELSMIVLLPVEINGLKQLEEQLTADKLLEW 266

  Fly   259 ALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLR 322
            ...:.|.|..:.:.||:|.:|.:..|..||:.:|..:.| ...|:|..:.::..|.::.||.|..
Mouse   267 TRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSKVLHKSF 331

  Fly   323 INLNESGSGSGPELPKNATEYKPIVISNSSRQ--KFFRADHPFFFAI--RSENVTYLMGHV 379
            :.:||.|:        .|.....:.:|.:|.|  :.|..||||.|.|  |..|.....|.:
Mouse   332 VEVNEEGT--------EAAAATGVEVSLTSAQIAEDFCCDHPFLFFIIHRKTNSILFFGRI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 94/384 (24%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 94/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.