DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:368 Identity:96/368 - (26%)
Similarity:164/368 - (44%) Gaps:43/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQL------RLKQRFAS-NAKMANFYAAELGNITTD 87
            |:.:||..:.:.::::|||:.|.||.:|.|..      .:..||.| ||.:..          ..
Human    27 NIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRFQSLNADINK----------RG 81

  Fly    88 ADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVGGGSWKD 152
            |...|:|.|||..........:|....|..:.|....||.:...:..|....|.:.....|...:
Human    82 ASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPE 146

  Fly   153 IHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELR 215
            :..:|.....|.|:|: |...:..|...|....|....|. :....|:|.|::....|. :..:.
Human   147 LLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFA-YGYIE 210

  Fly   216 DLDARAIELPYEHAEELSMLLILP----NQRGGLQELEKQLHDLDLGALQQRMQMEG-----VQV 271
            ||..|.:||||: .|||||:::||    ::..||:::|:|   |.|..|.:..:.|.     |.|
Human   211 DLKCRVLELPYQ-GEELSMVILLPDDIEDESTGLKKIEEQ---LTLEKLHEWTKPENLDFIEVNV 271

  Fly   272 LLPKFSIDFECSLRQPLKQLGFEEIFAAS-ANFKHLHASANLPIADVLQKLRINLNESGSGSGPE 335
            .||:|.::...:|...|.:||.:::|.:| |:...:..:.::.|:.::.|..:.:||.|:.:...
Human   272 SLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAA 336

  Fly   336 LPKNATEYKPIVISNSSRQKFFRADHPFFFAIR---SENVTYL 375
            ....||....:...|      |.|||||.|.||   |.::.:|
Human   337 TAGIATFCMLMPEEN------FTADHPFLFFIRHNSSGSILFL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 96/368 (26%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 96/368 (26%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.