DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina12

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:358 Identity:86/358 - (24%)
Similarity:157/358 - (43%) Gaps:47/358 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRF 67
            :|...|.::...|..:...:|::..:.|:.:|||.:....|:|.||:..:|.||:::....|:..
  Rat    44 DARELTRHNMEFGFKLLQRLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMS 108

  Fly    68 ASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHA---TAECVDLEQ 129
            ..:..|...|..:..|..|. |..:.:.|.|.:.........|.|:|:..:.|   .....|||.
  Rat   109 DRDMHMGFHYLLQKLNRETQ-DVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLEN 172

  Fly   130 TEK-LRRHIS-------EQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTG 186
            |:| :.::||       |.::.::..|:             .:||......|.:|...|...:|.
  Rat   173 TQKNINKYISRKTHNRIENMVKNIDPGT-------------VMLLTNYIYFQGRWQYEFDPKQTK 224

  Fly   187 LYEF--HSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELE 249
            ..:|  ..|..|| |||:|...|: ..|....|....:|:||.  ..::...:||:. |.|:.||
  Rat   225 EEDFFIEEGKTVK-VPMMFQRGMY-DMAYDSQLSCTILEMPYR--RNITATFVLPDS-GKLRLLE 284

  Fly   250 KQLHDLDLGA-----LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHAS 309
            :.| ..|:.|     |.:|:    |.|.:|:..|....::::.|.:||..:||....:...:.:.
  Rat   285 QGL-QADIFAKWKSLLSKRV----VDVWVPRLHISATYNMKKVLSRLGISKIFEEHGDLTRISSH 344

  Fly   310 ANLPIADVLQKLRINLNESG----SGSGPE-LP 337
            .:|.:.:.:.|..:.:||.|    :|||.: ||
  Rat   345 RSLKVGEAVHKAELRMNEKGTEGAAGSGAQTLP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 83/343 (24%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 84/351 (24%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.