DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpine1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:403 Identity:109/403 - (27%)
Similarity:174/403 - (43%) Gaps:76/403 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAA 79
            |..::..:..:..::|||.||..:.:.|::|.:.:.|.|..::|..:..|......|......:.
Mouse    39 GVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLSK 103

  Fly    80 EL------GNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHIS 138
            ||      ..|:|....|:|....|:    .|....|.|:.||    ..:.||..:.|:.|..|:
Mouse   104 ELMGPWNKNEISTADAIFVQRDLELV----QGFMPHFFKLFQT----MVKQVDFSEVERARFIIN 160

  Fly   139 EQILASVGGGSWKDIHVAGGSS----------ANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-- 191
            :          |.:.|..|..|          ...|:|:.|.....:|..||....|....||  
Mouse   161 D----------WVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKS 215

  Fly   192 SGSQVKSVPMLFDDDMF--VKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHD 254
            .||.| ||||:...:.|  .:|.....|:...:||||: .:.|||.:..|        .||.:| 
Mouse   216 DGSTV-SVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQ-GDTLSMFIAAP--------FEKDVH- 269

  Fly   255 LDLGALQQRMQMEGVQ------------VLLPKFSIDFECSLRQPLKQLGFEEIFAAS-ANFKHL 306
              |.||...:..|.::            ::|||||::.|..||.||::||..::|:|: |:|..|
Mouse   270 --LSALTNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSL 332

  Fly   307 HASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR--- 368
            .....|.:|..|||:||.:||||:     :..::|.:   |||..........|..|.|.:|   
Mouse   333 SDQEQLSVAQALQKVRIEVNESGT-----VASSSTAF---VISARMAPTEMVIDRSFLFVVRHNP 389

  Fly   369 SENVTYLMGHVVE 381
            :|.:.: ||.|:|
Mouse   390 TETILF-MGQVME 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 106/396 (27%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 109/403 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.