DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina6

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:367 Identity:88/367 - (23%)
Similarity:157/367 - (42%) Gaps:33/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNA 71
            ||..|  ....:|..:....:::|.::||:.:...|::|.|.:.|:|  :..:.|.......|.|
Mouse    36 PTNVD--FAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGST--QYLENLGFNMSKMSEA 96

  Fly    72 KMANFYAAELGNITTDADTFLQLQ--NRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLR 134
            ::...: ..|.::...:||.|::.  |.:.|.....:.|.|....:.|:.:.|..:..:...|..
Mouse    97 EIHQGF-QYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAG 160

  Fly   135 RHISEQILASVGGGSWKDIHVAGG-SSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH--SGSQV 196
            ..|:..:.....|   |..||... .|:.||:|:....|:..|.||||...|...:|:  ..|.|
Mouse   161 EQINNHVKNKTQG---KIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTV 222

  Fly   197 KSVPMLFDDDMFVKFAELRD--LDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGA 259
            | |||:........|   ||  :..:.:::.|  ....:..:|||:| |.:..:...|:...:..
Mouse   223 K-VPMMVQSGNISYF---RDSAIPCQMVQMNY--VGNGTTFIILPDQ-GQMDTVVAALNRDTIDR 280

  Fly   260 LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRIN 324
            ..:.|....:.:.:||||:.....|:..|..:|.:::|...::|........|.:. ||.|..:.
Mouse   281 WGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLT-VLHKAMLQ 344

  Fly   325 LNESGSGSGPELPKNATEYKPIVI-SNSSRQKFFRADHPFFF 365
            |:|     |..||. ||...|:.: |.|...|:.|   ||.|
Mouse   345 LDE-----GNVLPA-ATNGPPVHLPSESFTLKYNR---PFIF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 85/356 (24%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 85/358 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.