DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA3

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:368 Identity:85/368 - (23%)
Similarity:164/368 - (44%) Gaps:23/368 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:.....::||:.|||.:...|:.|.||:...|..|:.|.|:......|.|::...:...|.
Human    60 LYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLR 124

  Fly    83 NITTDADTF-LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVG 146
            .:...:|.. |.:.|.:.:..:..:.|.|.:.|:..:.:.|...|.:.:...::.|::.:.....
Human   125 TLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTR 189

  Fly   147 G---GSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDM 207
            |   ...||:     .|...::|:.....::||.:||....|....|: |..:...|||:....:
Human   190 GKITDLIKDL-----DSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHL 249

  Fly   208 FVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGV-QV 271
            .:.:....:|....:||.|  ....|.|.|||:| ..::|:|..|....|...:..::...: ::
Human   250 TIPYFRDEELSCTVVELKY--TGNASALFILPDQ-DKMEEVEAMLLPETLKRWRDSLEFREIGEL 311

  Fly   272 LLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGPEL 336
            .||||||..:.:|...|.|||.||.|.:.|:...:..:.||.::.|:.|..:::.|.|:.:..  
Human   312 YLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASA-- 374

  Fly   337 PKNATEYKPIVISN-SSRQKFFRADHPFFFAI---RSENVTYL 375
               ||..|..::|. ...:...|.:.||...|   .::|:.::
Human   375 ---ATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFM 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 85/368 (23%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 85/368 (23%)
RCL 369..394 5/29 (17%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.