DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb7

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_081824.1 Gene:Serpinb7 / 116872 MGIID:2151053 Length:380 Species:Mus musculus


Alignment Length:393 Identity:100/393 - (25%)
Similarity:171/393 - (43%) Gaps:38/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL----K 64
            |||     ...|..::..:.:|....||..|.|.:...|:|:.||:.|..|.::.|.|..    :
Mouse     6 AAN-----AEFGFDLFREMDSSQGNGNVFFSSLSIFTALTLIRLGARGDCARQIDKALHFNIPSR 65

  Fly    65 QRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGV----ADDFQK----IAQTYFHAT 121
            |..:||.:....|  :|..:..|.::   ......||..:||    ..||.|    .|:..::|.
Mouse    66 QGNSSNNQPGLQY--QLKRVLADINS---SHKDYELSIATGVFAEKVYDFHKNYIECAENLYNAK 125

  Fly   122 AECVDL-EQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRT 185
            .|.||. ...:..|..|::.|.....|...|.:..:..||:..::|:.|...:.||...|:...|
Mouse   126 VERVDFTNDVQDTRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKTDT 190

  Fly   186 GLYEFHSGS-QVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELE 249
            ....|.|.: ..|.|.|:..:..| ..:.::....:.:||.|...  :||.::||..  ||.|:|
Mouse   191 LSCRFRSPTCPGKVVNMMHQERRF-NLSTIQQPPMQVLELQYHGG--ISMYIMLPED--GLCEIE 250

  Fly   250 KQLHDLDL--GALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASAN 311
            .:|...:|  ...:::|:.:.|.|.||:|.|:....:...||.||.::|| .:||:...:.:...
Mouse   251 SKLSFQNLMDWTNRRKMKSQYVNVFLPQFKIEKNYEMTHHLKSLGLKDIFDESSADLSGIASGGR 315

  Fly   312 LPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            |.::.::.|..|.::|.|:.:......|      ||.........||||.||.|.|:..::....
Mouse   316 LYVSKLMHKSFIEVSEEGTEATAATENN------IVEKQLPESTVFRADRPFLFVIKKNDIILFT 374

  Fly   377 GHV 379
            |.|
Mouse   375 GKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 95/377 (25%)
Serpinb7NP_081824.1 SERPIN 4..380 CDD:294093 100/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.