DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb5

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476449.2 Gene:Serpinb5 / 116589 RGDID:69342 Length:375 Species:Rattus norvegicus


Alignment Length:371 Identity:93/371 - (25%)
Similarity:178/371 - (47%) Gaps:53/371 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK---------QRFASNA-KMANFYAAELGNI 84
            |::.||:.|..:|||..:|:.|.||.|:.:.|..:         |...|:. |:::||:      
  Rat    27 NILFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTITSDVNKLSSFYS------ 85

  Fly    85 TTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGG 148
                   |:|..||.:.....::.:|....:..:....|.||. ::.|:.:..|:..| ..:..|
  Rat    86 -------LKLIKRLYIDKSLNLSTEFISSTKRPYANELETVDFKDKLEETKGQINSSI-KELTDG 142

  Fly   149 SWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKF 211
            .::||......|..|.:|:: ||....||...|....|....|. :.:..|.|.|:..:..|. .
  Rat   143 HFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRINKTDTKPVQMMNLEATFC-L 206

  Fly   212 AELRDLDARAIELPYEHAEELSMLLILP----NQRGGLQELEKQLHDLDLGALQ----QRMQMEG 268
            ..:.|::.:.||||::: :.||||::||    ::..||:::||||:...|  ||    ..|....
  Rat   207 GNIDDINCKIIELPFQN-KHLSMLIVLPKDVEDESTGLEKIEKQLNPETL--LQWTNPSTMANAK 268

  Fly   269 VQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESGSGS 332
            |::.||||.::.....:..|:.||.:.:| .::::|..:..:..:.:::|:.::.:.:.|.| |.
  Rat   269 VKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETKGVSVSNVIHRVCLEITEDG-GD 332

  Fly   333 GPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR---SENVTYL 375
            ..|:|.:.      ::.:...   |:|||||.|.:|   :.|:.:|
  Rat   333 SIEVPGSR------ILQHKDE---FKADHPFLFIVRHNKTRNIVFL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/371 (25%)
Serpinb5NP_476449.2 serpinB5_maspin 1..375 CDD:381013 93/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.