DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpini1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_446231.1 Gene:Serpini1 / 116459 RGDID:619896 Length:410 Species:Rattus norvegicus


Alignment Length:397 Identity:95/397 - (23%)
Similarity:176/397 - (44%) Gaps:40/397 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQ-----KQLRL 63
            ||.|..........:|:.:..:..::|::.|||.:...:.::.||:.|:|.:|::     :.|:.
  Rat    19 AAFPDETIAEWSVNVYNHLRATGEDENILFSPLSIALAMGVMELGAQGSTLKEIRHSMGYESLKS 83

  Fly    64 KQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLE 128
            .:.|:.....::..:||.|...      :::.|.|.:.:...:.::|.::.:.||:|....||..
  Rat    84 GEEFSFLRDFSSMVSAEEGQYV------MKIANSLFVQNGFHINEEFLQMMKMYFNAEVNHVDFS 142

  Fly   129 QTEKLRRHISEQILASVGGGSWKDIHVAGGSSANT-LLLLLAANLQSKWFLPFSAYRTGLYEFHS 192
            :...:..:|::.: .:......||:...|...|.| |.|:.|...:..|...|....|..:.|..
  Rat   143 ENVAVANYINKWV-ENYTNSLLKDLVSPGDFDAVTHLALINAVYFKGNWKSQFRPENTRTFSFTK 206

  Fly   193 GSQVK-SVPMLFDDDMFVKFAELRDLDARA------IELPYEHAEELSMLLILPNQRGGLQELEK 250
            ..:.: .:||::....|. :.|..|....|      :|:||| .:|:||:|:|..|...|..||.
  Rat   207 DDESEVQIPMMYQQGEFY-YGEFSDGSNEAGGIYQVLEIPYE-GDEISMMLVLSRQEVPLATLEP 269

  Fly   251 QLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIA 315
            .|....:......::.:.|:|.||:|:::.|..|:..||.||..|||...||...:.....|.::
  Rat   270 LLKPQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLS 334

  Fly   316 DVLQKLRINLNESGS----GSGP-ELPKNATEYKPIVISNSSRQKFFRADHPFFFAI--RSENVT 373
            ..:.|..|.:||.||    .||. .:.:.|..:..:::           ||||.|.|  |.....
  Rat   335 KAVHKSFIEVNEEGSEAAVASGMIAISRMAVLFPQVIV-----------DHPFLFLIKNRKTGTI 388

  Fly   374 YLMGHVV 380
            ..||.|:
  Rat   389 LFMGRVM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/380 (24%)
Serpini1NP_446231.1 neuroserpin 23..410 CDD:239003 92/393 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.