DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpina10

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:404 Identity:97/404 - (24%)
Similarity:160/404 - (39%) Gaps:64/404 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLR------- 62
            ||.:......|..:|..||... :.|:..||..:...||.|.||:.|.|.::|...|.       
 Frog    67 ANVSQMSSDFGFNLYRKIANKH-DNNIFFSPFSVSLGLSSLLLGTRGNTYDQLLHGLNYNPFKDQ 130

  Fly    63 ------------LKQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQ 115
                        :|::.|.|.::    ...:|:::...:||             .:.|:|..:.:
 Frog   131 ENPYLLPELLKTIKEKIAKNEEL----VLNIGSLSFLHETF-------------SMKDEFVNLTK 178

  Fly   116 TYFHATAECVDLEQTEKLRRHISEQILASVGG--GSWKDIHVAGGSSANTLLLLLAANLQSKWFL 178
            .||....|.:|. .:.|.:..|:..:.....|  .::.|..    .....||||.....:.||..
 Frog   179 KYFDMEYELIDF-HSSKAKNEINAYVEKLTKGLISNFYDFI----DPQTKLLLLDYIFFKGKWQY 238

  Fly   179 PFSAYRTGLYEFHSGS-QVKSVPMLFDDDMFVKFAEL--RDLDARAIELPYEHAEELSMLLILPN 240
            ||:...|.:..|.... ...:|||::..|   |.|.:  :||.....:|||.  ....||:|.|.
 Frog   239 PFNPALTEVDSFFIDKYNSVTVPMMYKTD---KVASVFDKDLSCTVFKLPYR--GNAHMLIIKPE 298

  Fly   241 QRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKH 305
            :.|....||..|....:.:.|.:||.....:..|||.:|.:..|:..|.:||.:|:|...||...
 Frog   299 KEGDFGILEDHLTKELINSWQAKMQSRKTDIFFPKFKLDQKYKLKSSLNELGIKELFTGKANLTD 363

  Fly   306 LHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYK-PIVISNSSRQKFFRADHPFFFAIRS 369
            |....||.:.::.|:..|.::|.|:.:..........|. |:.|         |.:.||.|.|..
 Frog   364 LTEERNLMLTEITQQAMIEVDERGTEAAAVAGAEIIAYSLPLTI---------RVNRPFLFMIFE 419

  Fly   370 ENVTYL--MGHVVE 381
            |....|  :|.|::
 Frog   420 EAYQSLLFLGRVMD 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/387 (24%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 97/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.