DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpina10b

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:378 Identity:102/378 - (26%)
Similarity:159/378 - (42%) Gaps:42/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..| :|..::|||.|||.:....|.|.|.:.|:|..|:.|.|.|:             |.:.|
Zfish    42 LYRKI-SSLHDRNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLE-------------ALDGG 92

  Fly    83 NITTDADTFLQLQNRLMLSSESGVA----------DDFQKIAQTYFHATAECVDLEQTEKLRRHI 137
            :.....:.|.||...:.|..|.|.|          .:|.:..|.:|:|....||..:....|..|
Zfish    93 DSRRVPELFQQLHQNISLQMEQGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLI 157

  Fly   138 SEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGS-QVKSVP 200
            :|.:....|.   |.:.:.......|.:||| ....:..|..||:...|....|:... .:..||
Zfish   158 NEFVSRKTGR---KVLEMLESVEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVP 219

  Fly   201 MLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQ 265
            |:..::.| ...|.|||.||.:.|||...  .|||::||:.......:|.::....|....:.|:
Zfish   220 MMMLEEKF-SVVEDRDLRARVLRLPYRGG--ASMLILLPSADADYTAIEDEISAERLHGWIKNMR 281

  Fly   266 MEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGS 330
            ...::|.||:|.:|....:.:.|.|||...:|..||:...|...|:|.::.||.|..|.:.|.|:
Zfish   282 RMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAHLKVSQVLHKAVIEVYEQGT 346

  Fly   331 GSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYL--MGHVVE 381
            .:........|.|        |....|..:.||||.:..|....|  ||.|::
Zfish   347 SAASSTSVGITAY--------SLPDTFIINRPFFFFLYHEETASLLFMGRVID 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/374 (27%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 102/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.