DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and SPAG6

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_036575.1 Gene:SPAG6 / 9576 HGNCID:11215 Length:509 Species:Homo sapiens


Alignment Length:409 Identity:81/409 - (19%)
Similarity:149/409 - (36%) Gaps:84/409 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQFEAAWALTNIASGTSDQTRC 150
            ||  :|...::.:|.:|  |:.:...|::.: :|.|.......:|..||.||..:|:...|....
Human    19 QF--VQMVAELATRPQN--IETLQNAGVMSL-LRTLLLDVVPTIQQTAALALGRLANYNDDLAEA 78

  Fly   151 VIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHNVIDGILPLINNETPLSFL 215
            |::.:.:|..|..|..::....:.|.:.|..:..........::....:|.::            
Human    79 VVKCDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQAIVDCGALDTLV------------ 131

  Fly   216 RNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADACWALSYVTDDDNTKIQAVVD 280
                     :|                      |...|..|...|.|||.|:...:....|||||
Human   132 ---------IC----------------------LEDFDPGVKEAAAWALRYIARHNAELSQAVVD 165

  Fly   281 SDAVPRLVKLLQMDEPSIIVP--ALRSVGNIVTGTDQQTDVVIASGGLPRLGLLLQHNKSNIVKE 343
            :.|||.||..:|  ||.|.:.  |..::.:|...:.:....|:.:|.:..|..::.:..:.:..:
Human   166 AGAVPLLVLCIQ--EPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQ 228

  Fly   344 AAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAVTNTTTSGTPE-------- 400
            ....:|.::..:....:.|::|.||..:.|.|:..|...:|.|: .:.......|||        
Human   229 ILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNAS-TLIREIAKHTPELSQLVVNA 292

  Fly   401 ----QIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEEMGGLD 461
                .::|.|...|                   ..|.|..:..|......:|||.:.|....|:.
Human   293 GGVAAVIDCIGSCK-------------------GNTRLPGIMMLGYVAAHSENLAMAVIISKGVP 338

  Fly   462 KLETLQQHENEEVYKKAYA 480
            :|......|.|:..|.|.|
Human   339 QLSVCLSEEPEDHIKAAAA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 81/409 (20%)
HEAT repeat 70..102 CDD:293787 4/15 (27%)
armadillo repeat 108..140 CDD:293788 8/31 (26%)
armadillo repeat 148..184 CDD:293788 6/35 (17%)
armadillo repeat 190..225 CDD:293788 1/34 (3%)
armadillo repeat 359..396 CDD:293788 9/36 (25%)
armadillo repeat 402..437 CDD:293788 5/34 (15%)
SPAG6NP_036575.1 ARM 1 31..70 10/41 (24%)
armadillo repeat 37..68 CDD:293788 8/31 (26%)
ARM 2 73..112 7/38 (18%)
armadillo repeat 78..110 CDD:293788 6/31 (19%)
SRP1 112..>423 CDD:227396 59/311 (19%)
ARM 3 115..154 10/81 (12%)
armadillo repeat 120..152 CDD:293788 9/74 (12%)
ARM 4 157..196 16/40 (40%)
armadillo repeat 160..196 CDD:293788 16/37 (43%)
ARM 5 199..238 4/38 (11%)
armadillo repeat 202..234 CDD:293788 3/31 (10%)
ARM 6 241..280 9/39 (23%)
armadillo repeat 244..278 CDD:293788 9/34 (26%)
HEAT repeat 289..325 CDD:293787 6/54 (11%)
ARM 7 325..365 11/33 (33%)
HEAT repeat 335..369 CDD:293787 7/23 (30%)
ARM 8 368..409
HEAT repeat 378..406 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.