DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and AT1G32880

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_174565.1 Gene:AT1G32880 / 840182 AraportID:AT1G32880 Length:183 Species:Arabidopsis thaliana


Alignment Length:238 Identity:65/238 - (27%)
Similarity:102/238 - (42%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LSYVT--DDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGGL 326
            :||:|  :|....|:.|:.|.||.||::.| :||                             ..
plant     4 VSYITCAEDMRGPIETVIRSGAVHRLIQFL-LDE-----------------------------SF 38

  Fly   327 PRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAVT 391
            |:|                              |:||.|.:...|..:.:..:|..:||:..|::
plant    39 PKL------------------------------QSVIDANLIPTLVKLTQNAEFDMKKESVCAIS 73

  Fly   392 NTTTSGTPEQIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLFAL--AEKLGGTE-NLCLM 453
            |.|..|:.:||..::|: ..:||..|:|...|.:||.....|:.|...:  |||..|.: :....
plant    74 NATLLGSHDQIKYMVEQ-SCIKPLCDILFCPDVKTILKCLDGMENTLKVGEAEKNAGDDVSWYTR 137

  Fly   454 VEEMGGLDKLETLQQHENEEVYKKAYAIIDTYFSNGDDEAEQE 496
            :.|..||||:..||:|||.|:|.||..|:.||:...|||..|:
plant   138 LIEAEGLDKILNLQRHENIEIYDKALKILQTYWLEEDDEDIQQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 65/238 (27%)
HEAT repeat 70..102 CDD:293787
armadillo repeat 108..140 CDD:293788
armadillo repeat 148..184 CDD:293788
armadillo repeat 190..225 CDD:293788
armadillo repeat 359..396 CDD:293788 11/36 (31%)
armadillo repeat 402..437 CDD:293788 10/34 (29%)
AT1G32880NP_174565.1 armadillo repeat 41..78 CDD:293788 12/66 (18%)
ARM 44..166 CDD:237987 41/122 (34%)
armadillo repeat 84..117 CDD:293788 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4139
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.