DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and ABAP1

DIOPT Version :10

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0287720 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_196810.5 Gene:ABAP1 / 831145 AraportID:AT5G13060 Length:737 Species:Arabidopsis thaliana


Alignment Length:174 Identity:31/174 - (17%)
Similarity:58/174 - (33%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TILGVACDLGENMGLLPGYASNKLPPWSMLLIGASSCFLGFGVLWLSVSQIVLGLPF--WLLFVA 114
            |:.|.:.||......:|..:......|:....|....:.....:.:|:....||..|  |:...|
plant   155 TLDGNSTDLCHLHCSVPSNSPTLSYSWTYRDTGTDRLYANGSTITVSLKDKALGAEFTCWVQNPA 219

  Fly   115 LALATNSNSWFGTASLVTNMRNFPMSRGPVAGLLKGYIGISGAAFTVLFSMVLHHSAMDLLLFLT 179
                 :.||        |::..:|.......|..:||          |..:::..|.:.::|.:.
plant   220 -----HRNS--------TSVPLYPCGEAQTEGTGRGY----------LKPLIITMSLLCVILVVI 261

  Fly   180 VGIPVICLTVMY-----------------FIRPCIPATGEDPSE 206
            :.|..:|..|.|                 ::....|||..:..|
plant   262 IIIIAVCKAVCYKRRRVMQDKITLGHDIIYVDNSFPATSTNQGE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 31/174 (18%)
HEAT repeat 70..102 CDD:293787 3/31 (10%)
armadillo repeat 108..140 CDD:293788 7/33 (21%)
armadillo repeat 148..184 CDD:293788 6/35 (17%)
armadillo repeat 190..225 CDD:293788 5/34 (15%)
armadillo repeat 359..396 CDD:293788
armadillo repeat 402..437 CDD:293788
ABAP1NP_196810.5 SRP1 17..440 CDD:227396 31/174 (18%)
armadillo repeat 117..160 CDD:293788 2/4 (50%)
armadillo repeat 221..252 CDD:293788 8/48 (17%)
armadillo repeat 260..296 CDD:293788 4/35 (11%)
armadillo repeat 302..333 CDD:293788 1/4 (25%)
armadillo repeat 344..378 CDD:293788
armadillo repeat 385..416 CDD:293788
HEAT repeat 423..459 CDD:293787
armadillo repeat 500..534 CDD:293788
BTB_POZ_ARIA_plant 555..670 CDD:349661
BACK 664..727 CDD:475122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.