DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and Spag6l

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_056588.1 Gene:Spag6l / 50525 MGIID:1354388 Length:507 Species:Mus musculus


Alignment Length:392 Identity:85/392 - (21%)
Similarity:150/392 - (38%) Gaps:79/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHN 197
            |||||..||...::.::.|::..|:|..|..:|...:.|...|..||.:|:.........|:...
Mouse   145 AAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDAG 209

  Fly   198 VIDGILPLI-NNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADAC 261
            .|..:..:| |.:..|.  |.::..:|.:.::............:.||:...|..:|..|..:||
Mouse   210 AIAHLAQMILNPDAKLK--RQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNAC 272

  Fly   262 WALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGGL 326
            ..:..:........|.:|::..|..::..:...:.:|.:|.:..:|.:...::.....||.|.|:
Mouse   273 TLIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGV 337

  Fly   327 PRLGLLLQHNKSNIVK-EAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAV 390
            |:|.:.|.....:.:| .|||.:..:.....:..:||                          ||
Mouse   338 PQLSICLSEEPEDHIKAAAAWALGQLGRHTPEHARAV--------------------------AV 376

  Fly   391 TNT-----TTSGTPEQIVDLIEKYK--------------ILKPFIDLLDTKDPRTIKVVQTGLSN 436
            |||     :...:||...||..|.|              .|:||  |.|. .|..:|.|....|.
Mouse   377 TNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQKCTYLPALEPF--LYDA-PPNILKHVVGQFSK 438

  Fly   437 LF---ALAEKL----GGTENLCLMVEEMGGLDKLETLQQHEN-------EEVYKKAYAIIDTYFS 487
            :.   :.|.:|    ||.:.:..:..|.|.|     ||::.|       ||:.:        |:|
Mouse   439 VLPHDSKARRLFVTSGGLKKVQEIKAEPGSL-----LQEYINSINNCYPEEIVR--------YYS 490

  Fly   488 NG 489
            .|
Mouse   491 PG 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 85/392 (22%)
HEAT repeat 70..102 CDD:293787
armadillo repeat 108..140 CDD:293788 5/6 (83%)
armadillo repeat 148..184 CDD:293788 10/35 (29%)
armadillo repeat 190..225 CDD:293788 7/35 (20%)
armadillo repeat 359..396 CDD:293788 7/41 (17%)
armadillo repeat 402..437 CDD:293788 13/48 (27%)
Spag6lNP_056588.1 ARM 1 31..70
SRP1 <34..183 CDD:227396 12/37 (32%)
HEAT repeat 42..73 CDD:293787
ARM 2 73..112
HEAT repeat 85..109 CDD:293787
SRP1 112..>423 CDD:227396 65/307 (21%)
ARM 3 115..154 6/8 (75%)
armadillo repeat 120..152 CDD:293788 5/6 (83%)
ARM 4 157..196 10/38 (26%)
armadillo repeat 160..196 CDD:293788 10/35 (29%)
ARM 5 199..238 7/40 (18%)
armadillo repeat 202..236 CDD:293788 7/35 (20%)
ARM 6 241..280 7/38 (18%)
armadillo repeat 244..278 CDD:293788 7/33 (21%)
ARM 7 325..365 11/39 (28%)
armadillo repeat 328..360 CDD:293788 11/31 (35%)
HEAT repeat 378..406 CDD:293787 8/27 (30%)
ARM 8 402..441 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.