DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and spag6

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001002210.1 Gene:spag6 / 431757 ZFINID:ZDB-GENE-040704-53 Length:507 Species:Danio rerio


Alignment Length:444 Identity:85/444 - (19%)
Similarity:165/444 - (37%) Gaps:95/444 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SVDEIVAAMNSEDQERQFLGMQSARKM----LSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQ 130
            :||.:|.::...|.     |::.|...    ::|........::..|:||:.:..:|....: |:
Zfish   126 AVDALVISLEEFDP-----GVKEAAAWAIGNIARHNGQLSQAVVDAGVVPLLVLCIQEPEIA-LK 184

  Fly   131 FEAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIH 195
            ..||.||::||..:.:..:.|::..|:.|...::.:....|..|...|||.||.......::|:.
Zfish   185 RVAASALSDIAKHSPELAQTVVDTGAIAHLAQMILNPDAKLKRQVFSALGQIAKHSVDVAEMVVE 249

  Fly   196 HNVIDGILPLINNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADA 260
            ..:....|..:.:  |..::|            ||.:....::.:..|.|||:            
Zfish   250 AEIFPAALVCLKD--PDEYVR------------KNVATLIREITKHTPELSQM------------ 288

  Fly   261 CWALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGG 325
                             :|:...|..::..|...:.::.:|.:..:|.:...::.....||.|.|
Zfish   289 -----------------IVNVGGVAAVIDYLGDSKGNVRLPGIMMLGYVAAHSENLAMAVIVSKG 336

  Fly   326 LPRLGLLLQHNKSNIVKEA-AWTVSNITAGNQKQIQAVIQAGIFQQLRTVL------EKGDFKAQ 383
            :|:|.:.|:..:.:.||.| ||....|.....:..:.|..|.:|.:|..:.      |....||:
Zfish   337 VPQLAICLEEEQEDHVKAAIAWAFGQIGRHTPEHAKVVAVANVFPKLLNLYLDTESSEDLQVKAK 401

  Fly   384 KEAAWAVTNTTTSGTPEQIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLF---ALAEKLG 445
            |                .:..:::|...|.....||.......:|.|....|.:.   :.|.:|.
Zfish   402 K----------------GLKSILQKCTYLPALEPLLYEAPSNILKHVICQFSKVLPHDSKARRLF 450

  Fly   446 GTENLCLMVEEMGGLDKLETLQQHENEEVYKKAYAI-------IDTYFSNGDDE 492
            .|.         |||.|::.::......:.:...||       |..|:|.|..|
Zfish   451 VTS---------GGLKKVQEIKAEPGSAIQEYINAINNCYPEEIVRYYSPGYSE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 85/444 (19%)
HEAT repeat 70..102 CDD:293787 7/35 (20%)
armadillo repeat 108..140 CDD:293788 9/31 (29%)
armadillo repeat 148..184 CDD:293788 9/35 (26%)
armadillo repeat 190..225 CDD:293788 4/34 (12%)
armadillo repeat 359..396 CDD:293788 8/42 (19%)
armadillo repeat 402..437 CDD:293788 7/34 (21%)
spag6NP_001002210.1 armadillo repeat 37..68 CDD:293788
ARM 77..195 CDD:237987 16/74 (22%)
armadillo repeat 78..110 CDD:293788
armadillo repeat 120..152 CDD:293788 6/30 (20%)
armadillo repeat 160..196 CDD:293788 10/36 (28%)
ARM 161..279 CDD:237987 27/132 (20%)
armadillo repeat 202..233 CDD:293788 5/30 (17%)
armadillo repeat 244..278 CDD:293788 6/47 (13%)
ARM 245..363 CDD:237987 27/160 (17%)
HEAT repeat 293..316 CDD:293787 3/22 (14%)
HEAT repeat 327..363 CDD:293787 12/35 (34%)
ARM 330..432 CDD:237987 26/117 (22%)
HEAT repeat 378..406 CDD:293787 6/43 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.