DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and Kap-alpha3

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001163572.1 Gene:Kap-alpha3 / 41158 FlyBaseID:FBgn0027338 Length:514 Species:Drosophila melanogaster


Alignment Length:524 Identity:234/524 - (44%)
Similarity:327/524 - (62%) Gaps:12/524 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKADSNSRQGSYKANSINTQDSRMRRHEVTIELRKSKKEDQMFKRRNINDEDLTSPLKELNGQS 65
            |:..:.|..| ::|....:..:.|.||:|||:||||:|:|:.:.||||:.:.|..:..:|   |.
  Fly     1 MTSMEQNRLQ-NFKNKGKDQDEMRRRRNEVTVELRKNKREETILKRRNVPNLDSNTDEEE---QL 61

  Fly    66 PVQLSVDEIV-AAMNSEDQERQFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNTNNSML 129
            ...:.:.::. ||.::...|:|...:|:|||:||.::||||:.:|...|:||.:..|:..|::||
  Fly    62 SSSIDLKKLAKAAADATKPEQQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTML 126

  Fly   130 QFEAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVI 194
            ||||||||||||||||.||..|:...|||.|:.||.|.:.|:.||||||||||.|||...||.||
  Fly   127 QFEAAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVI 191

  Fly   195 HHNVIDGILPLINNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLAD 259
            .|.|:..:|..|..:.|::||||:.|::.||||||:|:||...:..:||.|:.|:...|..:|.|
  Fly   192 KHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVD 256

  Fly   260 ACWALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASG 324
            ..||:||:||..|.:||.|::|..||:|:.||...|..:...|||:|||||||:|:||.||:...
  Fly   257 TVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYD 321

  Fly   325 GLPRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWA 389
            .|.....||.|.|..|.|||.|.:||||||||.|:||||..|:..::...|.||:|:.|||||||
  Fly   322 ALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVINVGLLPKIIENLSKGEFQTQKEAAWA 386

  Fly   390 VTNTTTSGTPEQIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMV 454
            ::|.|.||..||:..|| |..::.||.|||..:|.:.|.||..||:|:..:|:  ...|.:...:
  Fly   387 ISNLTISGNREQVFTLI-KEGVIPPFCDLLSCQDTQVINVVLDGLNNMLKVAD--SHVEAVANCI 448

  Fly   455 EEMGGLDKLETLQQHENEEVYKKAYAIIDTYFSNGDDEAEQ-ELAPQEVNGALEFNATQPKAPEG 518
            ||..||.|:|.||.|||.|:||.||.|||.||:   ||.|| .:||........|:....:....
  Fly   449 EECEGLAKIERLQSHENVEIYKLAYEIIDQYFT---DEGEQTNMAPTSDGAQYNFDPHADRLTMN 510

  Fly   519 GYTF 522
            .:.|
  Fly   511 SFNF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 232/516 (45%)
HEAT repeat 70..102 CDD:293787 10/32 (31%)
armadillo repeat 108..140 CDD:293788 17/31 (55%)
armadillo repeat 148..184 CDD:293788 20/35 (57%)
armadillo repeat 190..225 CDD:293788 14/34 (41%)
armadillo repeat 359..396 CDD:293788 18/36 (50%)
armadillo repeat 402..437 CDD:293788 14/34 (41%)
Kap-alpha3NP_001163572.1 IBB 7..88 CDD:280005 26/84 (31%)
SRP1 8..500 CDD:227396 230/501 (46%)
ARM 104..224 CDD:237987 64/119 (54%)
armadillo repeat 104..137 CDD:293788 17/32 (53%)
armadillo repeat 145..181 CDD:293788 20/35 (57%)
armadillo repeat 187..222 CDD:293788 14/34 (41%)
ARM 236..350 CDD:237987 52/113 (46%)
armadillo repeat 239..264 CDD:293788 10/24 (42%)
armadillo repeat 272..308 CDD:293788 17/35 (49%)
armadillo repeat 314..348 CDD:293788 14/33 (42%)
ARM 315..433 CDD:237987 57/118 (48%)
armadillo repeat 356..390 CDD:293788 16/33 (48%)
armadillo repeat 399..433 CDD:293788 14/34 (41%)
Arm_3 442..485 CDD:292804 24/45 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444274
Domainoid 1 1.000 57 1.000 Domainoid score I7231
eggNOG 1 0.900 - - E1_COG5064
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.