DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and alphaKap4

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster


Alignment Length:478 Identity:123/478 - (25%)
Similarity:221/478 - (46%) Gaps:87/478 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TIELRKSKKEDQMFKRRNINDEDLTSPLKELNGQSPVQLSVDEIVAAMNSEDQERQFLGMQSARK 95
            |:.|.|:||            .:|...|...|..:..:|:..|:|..:|               |
  Fly    20 TLRLEKAKK------------AELQKELTIYNALTKCKLTSSEVVPDVN---------------K 57

  Fly    96 MLSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQFEAAWALTNIASGTSDQTRCVIEHNAVPHF 160
            :|.......:...:|||            |.:.::.:||.||.:||||:|:.:..:.:..|||..
  Fly    58 LLKSNTIGNLVESLGHG------------NKNKIRADAADALAHIASGSSEHSNLIAKAGAVPRL 110

  Fly   161 VALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHNVIDGILPLINNETPLS-FLRNIVWLMSN 224
            :.||||....:.|:.:.:|||:.......||.:|.|.::..::.:|.:::..: .|.::.|::..
  Fly   111 IRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRK 175

  Fly   225 LCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADACWALSYVTDDDNTKIQAVVDSDAVPRLVK 289
            ||.:..|||| |....::..|:.:|.:.:..||.||..|:..:...:.| ||.::|.:.|||::.
  Fly   176 LCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHGNET-IQMLLDFEVVPRIIY 238

  Fly   290 LLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGGLPRLGLLLQHNKSNIVKEAAWTVSNITAG 354
            ||:....::...||:::.||.||:::|...::.:..||.|..|:.::..:|..:....:.||..|
  Fly   239 LLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADG 303

  Fly   355 NQKQIQAVIQAGIFQQLRTVLE--KGDFKAQKEAAWAVTNTTTS--------------GTPEQIV 403
            |..|..|::.||:   |..:||  |.|..:.|.|| |:|.||.:              |...:..
  Fly   304 NIFQRHAIMNAGL---LHKILECLKADAISLKSAA-ALTITTLAIDKDKNLLCYLMRQGVIPEFC 364

  Fly   404 DLI--EKYKILKPFIDLLDTK---DPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEEMGGLDKL 463
            :|:  ::..||...:|:|.|.   ||              :.:.::.|      ::|..|.|:.:
  Fly   365 NLLFCQERDILSNVLDILSTMLDVDP--------------SFSAEVSG------IIEWSGALNNI 409

  Fly   464 ETLQQHENEEVYKKAYAIIDTYF 486
            ..||..|:||:...|..||..||
  Fly   410 RMLQSSEHEEIAAVARKIIGNYF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 123/478 (26%)
HEAT repeat 70..102 CDD:293787 5/31 (16%)
armadillo repeat 108..140 CDD:293788 8/31 (26%)
armadillo repeat 148..184 CDD:293788 11/35 (31%)
armadillo repeat 190..225 CDD:293788 7/35 (20%)
armadillo repeat 359..396 CDD:293788 15/38 (39%)
armadillo repeat 402..437 CDD:293788 8/39 (21%)
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 33/131 (25%)
armadillo repeat 98..134 CDD:293788 11/35 (31%)
armadillo repeat 140..176 CDD:293788 7/35 (20%)
ARM 189..301 CDD:237987 29/112 (26%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 12/35 (34%)
armadillo repeat 266..300 CDD:293788 5/33 (15%)
ARM 276..385 CDD:237987 30/112 (27%)
armadillo repeat 308..342 CDD:293788 14/37 (38%)
armadillo repeat 350..383 CDD:293788 5/32 (16%)
Arm_3 400..>433 CDD:292804 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.