DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and Spag6

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001099595.1 Gene:Spag6 / 291340 RGDID:1305616 Length:509 Species:Rattus norvegicus


Alignment Length:376 Identity:75/376 - (19%)
Similarity:142/376 - (37%) Gaps:64/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 AAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHHN 197
            |||||..||...::.::.|::..|||..|..:|...:.|...|..||.:|:.........|:...
  Rat   145 AAWALAYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDVG 209

  Fly   198 VIDGILPLINNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADACW 262
            .|..:..:|.|... ...:.::..:|::.::............:.||:...|..:|..|..:||.
  Rat   210 AIAHLAQMILNPDE-KLKQQVLSALSHIAKHSVDLAEMVVEAEIFPVVLTCLKDKDDFVKKNACT 273

  Fly   263 ALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGGLP 327
            .:..:........|.:|::..|..::..:...:.:|.:|.:..:|.:...::.....||.|.|:|
  Rat   274 LIREIAKHTPELSQLIVNAGGVAAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVP 338

  Fly   328 RLG-LLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAVT 391
            :|. .|.:..:.:|...|||.:..:.....:..:||                          |:|
  Rat   339 QLSDCLSEEPEDHIKAAAAWALGQVGRHTPEHARAV--------------------------AIT 377

  Fly   392 NT--------TTSGTPEQ--------IVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLF-- 438
            ||        .:|.:.|.        |.::|:|...|......|....|..:|.|....|.:.  
  Rat   378 NTLPVLLALYMSSESSEDLQVKSKKAIKNIIQKCTYLPALEPFLYDAPPNILKYVAGQFSKVLPH 442

  Fly   439 -ALAEKLGGTENLCLMVEEMGGLDKLETLQQHENEEVYKKAYAIIDTYFSN 488
             :.|.:|..|.         |||.|:        :|:..:..:|:..|.:|
  Rat   443 DSKARRLFVTS---------GGLKKI--------QEIKAEPGSILQEYINN 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 75/376 (20%)
HEAT repeat 70..102 CDD:293787
armadillo repeat 108..140 CDD:293788 5/6 (83%)
armadillo repeat 148..184 CDD:293788 11/35 (31%)
armadillo repeat 190..225 CDD:293788 5/34 (15%)
armadillo repeat 359..396 CDD:293788 6/44 (14%)
armadillo repeat 402..437 CDD:293788 9/34 (26%)
Spag6NP_001099595.1 armadillo repeat 34..70 CDD:293788
armadillo repeat 76..108 CDD:293788
SRP1 112..>423 CDD:227396 60/304 (20%)
armadillo repeat 127..152 CDD:293788 5/6 (83%)
armadillo repeat 162..194 CDD:293788 10/31 (32%)
armadillo repeat 202..238 CDD:293788 5/36 (14%)
armadillo repeat 244..278 CDD:293788 7/33 (21%)
armadillo repeat 328..360 CDD:293788 11/31 (35%)
HEAT repeat 378..406 CDD:293787 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.