DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pen and kpna7

DIOPT Version :9

Sequence 1:NP_477041.1 Gene:Pen / 34338 FlyBaseID:FBgn0267727 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001135557.1 Gene:kpna7 / 100216104 XenbaseID:XB-GENE-5991711 Length:523 Species:Xenopus tropicalis


Alignment Length:521 Identity:261/521 - (50%)
Similarity:354/521 - (67%) Gaps:18/521 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DSNSRQGSYKANSINTQDSRMRRHEVTIELRKSKKEDQMFKRRNI--NDEDLTSPLKELNGQSPV 67
            :::.|...:|....:|.:.|.||.||.:||||:||::|:.||||:  .:|.:.||.|.:.....|
 Frog     6 EADERMRKFKNKGKDTAELRRRRVEVNVELRKAKKDEQILKRRNVCFPEELVLSPEKNVMQSMQV 70

  Fly    68 -QLSVDEIVAAMNSEDQERQFLGMQSARKMLSRERNPPIDLMIGHGIVPICIRFLQNTNNSMLQF 131
             .||::|||..|||.|.|.:....|:||||||||||||::.:|..|::|..:.||...:||.|||
 Frog    71 PSLSLEEIVQGMNSGDTENELRSTQAARKMLSRERNPPLNDIIEAGLIPKLVDFLSRHDNSTLQF 135

  Fly   132 EAAWALTNIASGTSDQTRCVIEHNAVPHFVALLQSKSMNLAEQAVWALGNIAGDGAAARDIVIHH 196
            |||||||||||||||||:.|::..|:|.|::|:.|..::::||||||||||||||...||.:|:.
 Frog   136 EAAWALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVWALGNIAGDGPMYRDSLINC 200

  Fly   197 NVIDGILPLINNETPLSFLRNIVWLMSNLCRNKNPSPPFDQVKRLLPVLSQLLLSQDIQVLADAC 261
            |||..:|.|:|.:||:.:||||.|.:|||||||||.||...|.::||||:|||..:|..:|:|.|
 Frog   201 NVIPPLLALVNPQTPIGYLRNITWTLSNLCRNKNPYPPMSAVLQILPVLTQLLHHEDKDILSDTC 265

  Fly   262 WALSYVTDDDNTKIQAVVDSDAVPRLVKLLQMDEPSIIVPALRSVGNIVTGTDQQTDVVIASGGL 326
            ||:||:||..|.:|..||.:..|.||::|:...|.||:.|:||:|||||||||:||...|..|.|
 Frog   266 WAMSYLTDGSNDRIDVVVKTGIVERLIQLMYSPELSILTPSLRTVGNIVTGTDKQTQAAIDVGVL 330

  Fly   327 PRLGLLLQHNKSNIVKEAAWTVSNITAGNQKQIQAVIQAGIFQQLRTVLEKGDFKAQKEAAWAVT 391
            ..|..||:|.|.:|.|||||.:|||.||...|||.:|..|:...|..:|:||||||||||.||||
 Frog   331 SILPQLLRHQKPSIQKEAAWALSNIAAGPAPQIQQMITCGLLSPLVDLLKKGDFKAQKEAVWAVT 395

  Fly   392 NTTTSGTPEQIVDLIEKYKILKPFIDLLDTKDPRTIKVVQTGLSNLFALAEKLGGTENLCLMVEE 456
            |.|:.||.||:|.|:: ..:|:|.::||..||.:||.|:...:||:|..|||||..|.|||:|||
 Frog   396 NYTSGGTVEQVVQLVQ-CGVLEPLLNLLTIKDSKTILVILDAISNIFLAAEKLGEQEKLCLLVEE 459

  Fly   457 MGGLDKLETLQQHENEEVYKKAYAIIDTYFSNGDDEAEQELAPQEVNGALEFNATQPKAPEGGYT 521
            :|||:|:|.||.|:|..||..|.|:|:.|||.  :||:            |..|.:|:..:..||
 Frog   460 LGGLEKIEALQTHDNHMVYHAALALIEKYFSG--EEAD------------EMIALEPEVGKDTYT 510

  Fly   522 F 522
            |
 Frog   511 F 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PenNP_477041.1 SRP1 2..517 CDD:227396 258/514 (50%)
HEAT repeat 70..102 CDD:293787 18/31 (58%)
armadillo repeat 108..140 CDD:293788 17/31 (55%)
armadillo repeat 148..184 CDD:293788 17/35 (49%)
armadillo repeat 190..225 CDD:293788 17/34 (50%)
armadillo repeat 359..396 CDD:293788 22/36 (61%)
armadillo repeat 402..437 CDD:293788 12/34 (35%)
kpna7NP_001135557.1 SRP1 8..523 CDD:227396 261/519 (50%)
armadillo repeat 64..101 CDD:293788 15/36 (42%)
armadillo repeat 111..144 CDD:293788 17/32 (53%)
armadillo repeat 152..188 CDD:293788 17/35 (49%)
armadillo repeat 194..229 CDD:293788 17/34 (50%)
armadillo repeat 246..271 CDD:293788 14/24 (58%)
armadillo repeat 279..315 CDD:293788 17/35 (49%)
armadillo repeat 321..355 CDD:293788 16/33 (48%)
armadillo repeat 363..397 CDD:293788 20/33 (61%)
armadillo repeat 406..440 CDD:293788 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9986
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 505 1.000 Inparanoid score I1309
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4000
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.