DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and CG42397

DIOPT Version :10

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:56/131 - (42%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PTEECPEPNGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRS--- 143
            |...|.:.:.|.| :..|.:||.||.|....::|.||:.:          |...|: |...|   
  Fly    52 PPVLCADEDLFLP-APDCREYYQCLYGEGILKICPDGLYW----------DRELNV-CAWDSQHC 104

  Fly   144 ---KLQTPQPS-LHCPRKNGYFGHEKPGI--CDKFYFCVDGQFNM---ITCPAGLVFNPKTGICG 199
               |.:|..|| |:|.....:.    |.|  |.||..||   :|:   ::||:||.:|.....|.
  Fly   105 ADDKNETTTPSTLNCASGLPFL----PYIPDCTKFIQCV---YNIGFKLSCPSGLYWNQPLQSCD 162

  Fly   200 W 200
            :
  Fly   163 Y 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:426342 13/49 (27%)
CBM_14 156..204 CDD:426342 14/50 (28%)
CBM_14 233..278 CDD:426342
CG42397NP_001163428.1 CBM_14 58..102 CDD:426342 14/55 (25%)
ChtBD2 125..163 CDD:214696 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.