DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and CG10725

DIOPT Version :9

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:247 Identity:65/247 - (26%)
Similarity:98/247 - (39%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PGHPPSQRHLPPRNRD--PVQEASVVPKSKQTAAEKEYEPTEECPEPNGFYPDSKQCDKYYACLD 107
            |...|:..:...|:::  |:.|...:...|....             :.|..| :.|.||..|.|
  Fly    55 PRECPTDYYFDARDQECVPLMEVECIGSCKNRGL-------------SSFCYD-RTCTKYVLCFD 105

  Fly   108 GVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKR--SKLQTPQPSLHCPRKNGYFGHEKPGICD 170
            |.|..|.|:||:   .|:.:.::||.|..:||:..  |:...|...:..|.|         ..||
  Fly   106 GTPVIRQCSDGL---QYNALTDRCDYPQYVDCVDNLCSRNNNPDDIVFIPSK---------ARCD 158

  Fly   171 KFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCKSED--------------VFDFECPK 221
            |:|.|:||...:..|.:||.:||.|..|.:|.:|   .|..|.              :.|.|||.
  Fly   159 KYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKV---NCTVESLQRNILPFARAPPRLADIECPS 220

  Fly   222 VNESIAVTHPRYADPNDCQFFYVCVNGDLPRRNG----CKLGQVFDEEKETC 269
            ..... :.|.:..|.     :|.|:||     .|    |..|.|||.::|.|
  Fly   221 EGAHF-IAHQKRQDA-----YYYCLNG-----RGVTLDCTPGLVFDAKREEC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 17/49 (35%)
CBM_14 156..204 CDD:279884 16/47 (34%)
CBM_14 233..278 CDD:279884 13/41 (32%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 3/17 (18%)
CBM_14 83..134 CDD:279884 18/67 (27%)
CBM_14 150..192 CDD:279884 17/50 (34%)
ChtBD2 216..264 CDD:214696 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.