DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and CG7248

DIOPT Version :9

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:232 Identity:66/232 - (28%)
Similarity:87/232 - (37%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQTPQPS-LH 153
            ||||.....|..|..|.|.......|.||.:||  ||: :.||.|..:||   ..|..|.|| ..
  Fly    67 NGFYEYPYNCSAYITCYDSCADLEYCPDGKLFN--SPL-QICDTPGAVDC---EPLPYPTPSPTE 125

  Fly   154 CPRKNGYFGHEKPGI------CDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCK-S 211
            .|.:|...|.....:      |::||.||:.|..:..||..::|||...||...|.|...|.: :
  Fly   126 SPPENPCLGTRNNTLLPSAENCNEFYLCVNDQSKVYRCPGEMLFNPDLNICDDKDNVWCYGDRTT 190

  Fly   212 EDVFDFECPKVNESIAVTHPR-----YADPNDCQFFYVCVNGD----LPRRNGCKLGQVFDEEKE 267
            .|..|...| ..||......:     :.||.:||.:|.|....    ||    |.:...|:....
  Fly   191 PDPLDTTTP-AEESFTKCEDQEKGTFFPDPENCQQYYYCWGNKSYTILP----CPVDNWFNPISG 250

  Fly   268 TCDWARKVPDCADWYKDRLTDKELDELENPKPKTTTT 304
            .|.     ||.|.           |......|.:|.|
  Fly   251 NCG-----PDIAP-----------DACRETTPTSTPT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 18/48 (38%)
CBM_14 156..204 CDD:279884 16/53 (30%)
CBM_14 233..278 CDD:279884 12/48 (25%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884 18/48 (38%)
CBM_14 136..182 CDD:279884 14/45 (31%)
CBM_14 207..261 CDD:279884 15/73 (21%)
CBM_14 293..347 CDD:279884
CBM_14 367..421 CDD:279884
CBM_14 470..522 CDD:279884
CBM_14 544..597 CDD:279884
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.