Sequence 1: | NP_609339.1 | Gene: | obst-B / 34336 | FlyBaseID: | FBgn0027600 | Length: | 337 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034018.1 | Gene: | CG33985 / 3885639 | FlyBaseID: | FBgn0053985 | Length: | 277 | Species: | Drosophila melanogaster |
Alignment Length: | 265 | Identity: | 56/265 - (21%) |
---|---|---|---|
Similarity: | 82/265 - (30%) | Gaps: | 111/265 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 EECPEPN--GFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQ 146
Fly 147 ---------------------------------TPQPSLH---------------------CPR- 156
Fly 157 -----------KNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCK 210
Fly 211 SEDVFDFECPKVNESIAVTH-PR----------YADPNDCQFFYVCVNGDLPRRNGCKLGQVFDE 264
Fly 265 EKETC 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
obst-B | NP_609339.1 | CBM_14 | 89..139 | CDD:279884 | 14/51 (27%) |
CBM_14 | 156..204 | CDD:279884 | 13/59 (22%) | ||
CBM_14 | 233..278 | CDD:279884 | 12/37 (32%) | ||
CG33985 | NP_001034018.1 | CBM_14 | 28..74 | CDD:279884 | 14/48 (29%) |
CBM_14 | 160..202 | CDD:279884 | 13/50 (26%) | ||
ChtBD2 | 215..259 | CDD:214696 | 12/45 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |