DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and obst-E

DIOPT Version :9

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:254 Identity:79/254 - (31%)
Similarity:117/254 - (46%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ECPEPNGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCD-LPYNIDCMKRSKLQTP 148
            |||.|||.:....|||.|..|.||.|.|:||.||::|:..:....:|. .||: .|.:|::||..
  Fly    24 ECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYS-TCKERARLQPA 87

  Fly   149 QPSLHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGICGWPDQVGVTGCKSED 213
            ..:..|||:.|::.:.....|..:..|..|..::..||.||.||.:|..|.|||.  |..|.:|.
  Fly    88 NGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDL--VESCNAEA 150

  Fly   214 VFDFECP---KVNESIAV---THPR-----YADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKE 267
            ...|.||   ..::|.|.   ..|.     |..|..|:.::|||||. ||...|.....|:.:.:
  Fly   151 YLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGH-PRLYNCGKYLAFNSQTK 214

  Fly   268 TCDWARKVPDCADWYKDRLTDKELDELENPKPKTTTTKRPPRVRGQSRRKPQPKRVEPE 326
            .||:..|||:|....|::                      .|::.:   |.||:..:||
  Fly   215 LCDFYNKVPECYALLKEK----------------------QRLKAE---KQQPQVAQPE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 20/50 (40%)
CBM_14 156..204 CDD:279884 16/47 (34%)
CBM_14 233..278 CDD:279884 17/44 (39%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 20/40 (50%)
CBM_14 95..146 CDD:307643 17/52 (33%)
CBM_14 180..225 CDD:307643 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157817at2759
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.