DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and LOC3291167

DIOPT Version :10

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_554263.2 Gene:LOC3291167 / 3291167 VectorBaseID:AGAMI1_011587 Length:132 Species:Anopheles gambiae


Alignment Length:121 Identity:36/121 - (29%)
Similarity:51/121 - (42%) Gaps:23/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EPTEECPEPNGFY--PDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNI-DCMKR 142
            |||  | .|.|.|  .:.:.|..|:.|.||:....:|..|..|::   ..:.| ||..: :|.: 
Mosquito    24 EPT--C-RPTGQYLTANPRDCRSYFYCYDGIAYYGVCQQGFRFDE---SRQSC-LPSTVAECFE- 80

  Fly   143 SKLQTPQPSLHCPRKNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPKTGIC 198
                       ||.. |......|..|.||..|.:|..|..:||.||:||.:...|
Mosquito    81 -----------CPTM-GMVSLPHPTSCQKFVLCFEGVANERSCPTGLLFNRQIHQC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:426342 14/52 (27%)
CBM_14 156..204 CDD:426342 15/43 (35%)
CBM_14 233..278 CDD:426342
LOC3291167XP_554263.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.