DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and cbd-1

DIOPT Version :9

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:260 Identity:64/260 - (24%)
Similarity:108/260 - (41%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RVGPGHPPSQRHLPPR---NRDPVQEA--SVVPKSKQTAAEKEYEPTEECPEPNG--FYPDSKQC 99
            |:|...........||   .::.:::|  .::..:...|..|::|  ..|...:|  .:......
 Worm  1061 RIGKLFDSHSNRCVPRIGCGKEAIRDAIKDMIATTPAPAQPKQFE--GRCAHVDGEAVFSIGVCS 1123

  Fly   100 DKYYACLDGVPTERLCADGMVFNDYSPIE-------EKCDLPYNIDCMKRSKLQTPQPSLHCPRK 157
            .||..|..|....:.|::..||:: ..:|       ..|.:|.| ..:|:......|.:....::
 Worm  1124 SKYLRCSYGASKLQQCSEDRVFSN-DKLECIVRESVSACTVPKN-PSIKKYYTSNDQSAFCDGKE 1186

  Fly   158 NGYFGHEKPGICDKFYFCVDGQ-FNMITCPAGLVFNPKTGICGWPDQVGVTGCKSEDVFDFECPK 221
            :|.:.:|:.  |.....|..|: |...:|.:.|.||..||.|.:|.:  |:||::....:.||.:
 Worm  1187 DGLYRNERD--CSAILQCFGGELFEHPSCQSSLAFNQLTGKCDYPQK--VSGCENHGQTNGECSE 1247

  Fly   222 VNESIAVTHPRYADPNDCQFFYVCVNGDLPRR--NGCKLGQVFDEEKETCDWARKVPDCADWYKD 284
            ....|       ||.|:|:.||.||.|   |:  ..|..|.||:.....|||...||.|:....|
 Worm  1248 HGSFI-------ADANNCEVFYRCVWG---RKVVMTCPSGTVFNPLLSVCDWPSAVPSCSGQASD 1302

  Fly   285  284
             Worm  1303  1302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 12/58 (21%)
CBM_14 156..204 CDD:279884 14/48 (29%)
CBM_14 233..278 CDD:279884 19/46 (41%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643
CBM_14 785..836 CDD:307643
CBM_14 1108..1161 CDD:307643 10/53 (19%)
CBM_14 1182..1235 CDD:307643 15/56 (27%)
CBM_14 1251..1296 CDD:307643 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.