DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-B and R02F2.4

DIOPT Version :9

Sequence 1:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:225 Identity:64/225 - (28%)
Similarity:97/225 - (43%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YEPT----------EECPEPNGFYPDS------KQCDK-YYACLDGVPTERLCADGMVFNDYSPI 127
            |:||          :||.:.:|.|.:|      .:|.. :::|.:|:...|.|...:|||   |.
 Worm   155 YDPTNKKCSWKGMIDECSQVSGEYCESDGNISKSECSNVFFSCSEGIAHRRNCPANLVFN---PA 216

  Fly   128 EEKCDLPYNI-DCMKRSKLQTPQPSLHCPRKNGYFGHEKPGIC-DKFYFCVDGQFNMITCPAGLV 190
            ...||.|.|: ||.::|  :.||   :|...:|||..   |.| ..|..|.:|...::.||.||:
 Worm   217 ISSCDWPKNVMDCSEKS--EKPQ---NCGEVDGYFSF---GRCSSSFSACTNGIPIVMFCPDGLM 273

  Fly   191 FNPKTGICGWPDQVGVTGCKSEDVFDFECPKVNESIA----VTHPRYADPNDC-QFFYVCVNGDL 250
            |:.|..:|.:  :..|..|..|.....|..|.:|::.    :.:..||  .|| .....|.||  
 Worm   274 FSEKNQMCDY--EWNVDECDLESSGFMENYKASEALTPCTNMDNGLYA--LDCTPRVLSCQNG-- 332

  Fly   251 PRRN--GCKLGQVFDEEKETCDWARKVPDC 278
             |.|  .|....||:|....||:......|
 Worm   333 -RENIFECPPSLVFNENSLICDYPETSLKC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 16/57 (28%)
CBM_14 156..204 CDD:279884 15/48 (31%)
CBM_14 233..278 CDD:279884 15/47 (32%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 3/9 (33%)
CBM_14 185..229 CDD:279884 13/46 (28%)
ChtBD2 240..283 CDD:214696 15/45 (33%)
CBM_14 310..361 CDD:279884 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.