DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trp1 and SEC62

DIOPT Version :10

Sequence 1:NP_723510.1 Gene:Trp1 / 34333 FlyBaseID:FBgn0011584 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_015231.2 Gene:SEC62 / 856011 SGDID:S000006015 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:51/138 - (36%)
Similarity:74/138 - (53%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VDGSEAYVWIYDPIPLHYWIFGFILLLGAVGICL----FPLWPPLLRKGVYYLSIAAAGFLVFIL 253
            ::..|.:||.|:|    .....:::::|.|.|.|    :||||..:|:|.||:|:.|.|.|....
Yeast   132 LEADEYFVWNYNP----RTYMDYLIVIGVVSIILALVCYPLWPRSMRRGSYYVSLGAFGILAGFF 192

  Fly   254 ALTIVRLIVFI---IVWALTGGKLHFWIFPNLTEDVSFFASFWPLYESNYNSDPNNSSAKTDKKS 315
            |:.|:|||:::   ||:...||   |||||||.||.....||.|||  .:......|..|..|:.
Yeast   193 AVAILRLILYVLSLIVYKDVGG---FWIFPNLFEDCGVLESFKPLY--GFGEKDTYSYKKKLKRM 252

  Fly   316 KSKDKKKE 323
            |.|..|:|
Yeast   253 KKKQAKRE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trp1NP_723510.1 Sec62 108..299 CDD:461073 44/112 (39%)
SEC62NP_015231.2 SEC62 1..259 CDD:227557 49/135 (36%)

Return to query results.
Submit another query.