DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trp1 and AT3G20920

DIOPT Version :9

Sequence 1:NP_723510.1 Gene:Trp1 / 34333 FlyBaseID:FBgn0011584 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_566671.1 Gene:AT3G20920 / 821641 AraportID:AT3G20920 Length:365 Species:Arabidopsis thaliana


Alignment Length:391 Identity:80/391 - (20%)
Similarity:132/391 - (33%) Gaps:136/391 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 REQVIE------FLDVMLEHKFFHR--AKKVPVTLEEIRGKSGGDKKADKEKTQDKEKDKAKDEK 149
            |:|.::      |.:.:.:||....  |......:|..|||   |..:..:...|.:....:|:.
plant    33 RKQAVKKDSFQLFAEKVRDHKGLESRWAVMEQARVEYFRGK---DFVSFMKNNPDFKDILEEDKD 94

  Fly   150 KDTDPEGDNGQGDGGASGNEKEKEKKEKKKRKI-----RLDM-HPEQIFVDGSEAYVWIYDP-IP 207
            .|||...:...|.......::..:.....|:|:     .|:: ..:|.|.:....:.|.::. .|
plant    95 LDTDDIANVLLGKNLLVRCDRVTKTLRPGKKKLSTWPAHLEIFRDDQSFSENDAFFAWTFEKRHP 159

  Fly   208 LHYWIFGFILLLGAVGICLFPLWPPLLRKGVYYLSIAAAGFLVFILALTIVRLIVFIIVWALTGG 272
            |...:..|...:..:.|||||::|...:..|.|   :.||.|:.||:|..||.:.|..:|.|.|.
plant   160 LWQTLLSFFWPVLTLAICLFPVYPHRCKLIVLY---SCAGILLMILSLLFVRAVAFGAMWILLGK 221

  Fly   273 KLHFWIFPN-LTEDVSF--FASFWPLYESNYNSDPNNSSAKTDKKSKSKDKKKEKESDAEDTAVD 334
            ::  |.||| |.|:.:.  ...|||                          ||::|         
plant   222 RV--WFFPNILAEEATLKELFRFWP--------------------------KKDEE--------- 249

  Fly   335 ADGDADGDVDAEVSTLEPEK--------------IELIKEHDTDMEIRKR--RKV---------- 373
                            ||.|              :.|::.|..|...|.|  |::          
plant   250 ----------------EPPKWTSRLFYTVVAIVVVMLLRRHAPDEAARARYQRRMSNIIDDVLEW 298

  Fly   374 ------------------------------GADDYEEDDVDEEETKAQPKDSKAGTPRNSG-SDS 407
                                          |.|..||.|:|  ||:.:..|...|.....| :||
plant   299 SPKLALSGLMENQQPVNITDAANNSSDSAGGPDQTEEVDLD--ETQGEDLDETQGKEEAEGWTDS 361

  Fly   408 E 408
            :
plant   362 D 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trp1NP_723510.1 Sec62 105..303 CDD:281790 52/209 (25%)
AT3G20920NP_566671.1 Sec62 66..228 CDD:382874 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5232
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1474000at2759
OrthoFinder 1 1.000 - - FOG0005183
OrthoInspector 1 1.000 - - oto3249
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12443
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.