DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trp1 and sec62

DIOPT Version :9

Sequence 1:NP_723510.1 Gene:Trp1 / 34333 FlyBaseID:FBgn0011584 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_594256.1 Gene:sec62 / 2542396 PomBaseID:SPAC17G6.09 Length:273 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:70/275 - (25%)
Similarity:108/275 - (39%) Gaps:67/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KKNVKTKKTKFLSHIVEYFTSSKAIDALLKSKFTEGSN---PLFTTREQVIEFLDVMLEHKFFHR 111
            :..:|||........|.||...:.:..|....:|....   |..::||:.||.|.:::.:....|
pombe    28 RPELKTKPAILNGKRVYYFRVKRVLRFLTSEAYTPKKYKGFPEISSREEAIEVLKLLIMNSMLVR 92

  Fly   112 AKKVPVTLEEIRGKSGGDKKADKEKTQDKEKDKAKDEKKDTDPEGDNGQGDGGASGNEKEKEKKE 176
            ..|:|                                                         .|:
pombe    93 VDKLP---------------------------------------------------------PKQ 100

  Fly   177 KKKRKIRLDMHPEQIFVDGSEAYVWIYDPIPLHYWIFGFILLLGAVGICLFPLWPPLLRKGVYYL 241
            :|::.:.|.::..|.|.|... |||:|:|:|........:..|..:.:.||||||..:|||.:||
pombe   101 RKQKLVELQINRNQDFQDDMH-YVWLYEPLPKRVMALAVLFALVVLALVLFPLWPMFMRKGAWYL 164

  Fly   242 SIAAAGFLVFILALTIVRLIVFIIVWALTGGKLHFWIFPNLTEDVSFFASFWPLYESNYNSDPNN 306
            |:...|.:.....|.|:|..:|.|...:.  :...|:||||..||.|..||.||: |.:||   .
pombe   165 SMGGLGVIGLFFVLVILRFFLFCITAVIV--RPGIWLFPNLLADVGFCDSFKPLW-SWHNS---K 223

  Fly   307 SSAKTDKKSKSKDKK 321
            |..|..:|||...||
pombe   224 SEVKKTRKSKKLSKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trp1NP_723510.1 Sec62 105..303 CDD:281790 48/197 (24%)
sec62NP_594256.1 Sec62 1..245 CDD:295204 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2063
eggNOG 1 0.900 - - E1_COG5232
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005183
OrthoInspector 1 1.000 - - oto100450
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12443
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1311
SonicParanoid 1 1.000 - - X4215
TreeFam 1 0.960 - -
109.900

Return to query results.
Submit another query.