DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoYb and CG10077

DIOPT Version :9

Sequence 1:NP_001245959.1 Gene:SoYb / 34331 FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster


Alignment Length:512 Identity:92/512 - (17%)
Similarity:193/512 - (37%) Gaps:124/512 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 GKNPSERSVQKNRSQMPN---SNVSTT-------KRCVEKMHVCRSENMGDRKPSVCLKHLVLAH 468
            |:|..:|| ..:.:.:|.   |.|:.|       |.|...:    :..:|:.:..:....:.:..
  Fly    90 GQNGGQRS-SNHGAHLPKIVWSEVNLTPFRKNFYKPCDSVL----ARTVGETETFLTSNEITIKG 149

  Fly   469 SPEPVNPVTSYKELPLGNTILNAMDDLNFQTPLPTQIYAWPHLVNRGSLVLVNPSGTGRSWSYLP 533
            ...| .|...::|....:.::|.:....|..|...|...||..::...||.|..:|:|::.:|  
  Fly   150 DQVP-TPSIEFEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAY-- 211

  Fly   534 VICSSVLSSFENVTSNLDTRIAPGPLAILIVDSVENAKKLASHCEFLMKDFNTQNLKVVNTHAHS 598
                 ||.:..::.:........||:|:::..:    ::||...:.:..:|.:      |||.. 
  Fly   212 -----VLPAVVHINNQPRLERGDGPIALVLAPT----RELAQQIQQVAIEFGS------NTHVR- 260

  Fly   599 MMDVYMMLLNSC------------------GVLVTTLAHLNNILSNELPLVNPTRLEFIIFDDYD 645
                     |:|                  .:::.|...|.:.|  |....:..|..:::.|:.|
  Fly   261 ---------NTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFL--ERGTTSLKRCTYLVLDEAD 314

  Fly   646 RKRLDNA--ELLKEVFQKVNSIGGLSKQLVLVAQQWHSERFQKLLNRTTKPLILFGDFLEAALYG 708
            | .||..  ..::::.|::..    .:|:::.:..|..|..|           |..:||...:  
  Fly   315 R-MLDMGFEPQIRKIMQQIRP----DRQVLMWSATWPKEVRQ-----------LAEEFLNNYI-- 361

  Fly   709 GLKFNVTLRSSALKAR----QLLDILAEQDGSKK--------------RTLIYCKNQMELEELSA 755
                .|.:.|.:|.|.    |::|:..|.:...|              :|:|:.:.:..::|::.
  Fly   362 ----QVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITR 422

  Fly   756 ILIEAGLQCVDI--SKAQNQ---------SPNRLMLVDDSQVRKQLPVRNIQLLIHFSLPESWLR 809
            .:...|.:...|  .|:|.:         :....:||......:.|.|.:::.:|::..|.:...
  Fly   423 NISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSED 487

  Fly   810 FSRRF-HTMADN----IRNLFT-KPIGRGQDLITYILMDENNAKEWPRIMKFLQDHG 860
            :..|. .|...|    ...||| ....:..|||.  ::.|.|....|::|....:.|
  Fly   488 YVHRIGRTGRSNNTGTAYTLFTHSNANKANDLIQ--VLREANQTINPKLMNMAMNGG 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 80/441 (18%)
P-loop_NTPase 480..>646 CDD:304359 32/183 (17%)
TUDOR 927..1043 CDD:278965
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 92/512 (18%)
DEADc 159..364 CDD:238167 44/255 (17%)
HELICc 375..507 CDD:238034 20/131 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.